Typing tool

Complete norovirus genomes

MG892908  GII.13
 GII.P16

Length: 7,510 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7444
LOCUS       MG892908                7510 bp    RNA     linear   VRL 22-APR-2019
DEFINITION  Norovirus GII strain
            Hu/GII.P16-GII.13/RUS/Novosibirsk/NS17-A1008/2017, complete genome.
ACCESSION   MG892908
VERSION     MG892908.3
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7510)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Molecular epidemiology of noroviruses associated with sporadic
            gastroenteritis in Russia
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7510)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-2018) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
REFERENCE   3  (bases 1 to 7510)
  AUTHORS   Zhirakovskaya,E., Tikunov,A. and Kravchuk,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
  REMARK    Sequence update by submitter
COMMENT     On Apr 22, 2019 this sequence version replaced MG892908.2.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7510
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P16-GII.13/RUS/Novosibirsk/NS17-
                     A1008/2017"
                     /isolation_source="feces"
                     /host="Homo sapiens; sex: F; age: 24 Y"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="07-Apr-2017"
                     /note="genotype: GII.P16/GII.13"
     5'UTR           1..4
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AVO62475.2"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNEMAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFVISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMRIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTTKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="AVO62476.2"
                     /translation="MKMASNDAAPSNDGAASLVPEAINETMPLEPVAGASIAAPVAGQ
                     TNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAIPPNFPVDMISPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNVFYHFNNQPQPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFIYLVPP
                     SVESKTKPFTLPILTISELTNSRFPIPIEQLYTAPNENNVVQCQNGRCTLDGELQGTT
                     QLLSSAVCSYRGRTVANSGDNWDQNLLQLTYPSGASYDPTDEVPAPLGTQDFSGILYG
                     VLTQDNVSEGTGEAKNAKGVYISTTSGRFTPKIGTIGLHSITENVHPNQQSRFTPVGV
                     AQNENTPFQQWVLPHYAGALALNTNLAPAVAPTFPGEQLLFFRSRVPCVQGLQGQDAF
                     IDCLLPQEWVNHFYQEAAPSQADVALIRYVNPDTGRTLFEAKLHRSGFITVSHTGAYP
                     LVVPPNGHFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7444
                     /gene="ORF3"
     CDS             6713..7444
                     /gene="ORF3"
                     /codon_start=1
                     /product="minor capsid protein VP2"
                     /protein_id="QCD16865.1"
                     /translation="MAGAFIAGLAGDMLTSAVGSLTSAGANAINQKLNFDYNKQLQNA
                     SFQHDKEMLQAQIDATKKLQSEMIAIKHGVLTAGGFSPADAARGAVNAPMTRVLDWSG
                     TRYYAPNSVQTTSYSGQFTPSPVHRAQVKFPSNSSQRTAAPSSIRSLSTQSTSLGSTS
                     SRGSSAASSSSRTADWVQQQRALSPYMQGALQTAYVTPPSSRASSMSSVSTVPKGVLD
                     SWTPVFNTRRQPLFAHLRKRGESQA"
     3'UTR           7445..7510
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggct aggcccaaac agcctgcccc gagagacaaa ccacaaaagc ccccaagacc
      181 accaactccc gagttggtca agaggatacc ccctcctcca cctaatggcg aagaagaaga
      241 agaaccagtc attaggtatg aggtcaagag tgggatctct ggcctgcccg agctcacaac
      301 agtcccccaa ccggacgtgg ccaacacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggaa gccaaggaac cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactat ggcctgtacg tggagaaagg cttagtgttg ggtgtgcaca aaccacctgc
      481 agctataagc atggcaagag tggaactgac gccgctgtca ttgtactggc gtgtggtgta
      541 cactccccaa tacctcatct cccctgaaac tctcaggagg ctcaacggag aggcattccc
      601 ttacaccgcc tttgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctt agcaggagga tggtgcaaag aacaacgggc ttcttcagac cttaccaaga
      721 gtggaataga aaacccctgc ctaccatgga tgactccaaa attaagaagg tggcaaatat
      781 attcctatgt tcattgtcca cattattcac cagacccata aaagacctca taggaaaaat
      841 taaaccatta aacatattga atatcctggc aacgtgtgac tggacgtttg ccggaatagt
      901 ggagtctcta atattacttg ctgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac tcggggatta cgagttgcag gggccagaag acctcgccgt
     1021 tgaactcgta cccgtggtga tgggagggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacactcagg gcttgtaaag atcttggtgc
     1141 ctatggctta gagatactca aattggtcat gaagtggttc ttcccaaaga aagaggaggc
     1201 caatgagcta gccatggtga gggccataga ggatgctgta ctagatcttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccagaag gttgtccaca aaatctgcat cccctgacat
     1381 agttggaaca atcaatgccc tgctggctcg aatagcagcg gccaggtcat tagtccacag
     1441 ggccaaggaa gagctatcta gcaggataag accagtagtt gttatgatat ctggcaaacc
     1501 aggaataggc aaaactcatc tggccaggga ggtggcaaga aaggtggcat ccactctcac
     1561 aggggatcaa agagtcggac tcataccaag aaacggtgtg gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtgttgt gggacgacta tggcatgagt aaccccattc atgatgctct
     1681 tcgcatacaa gaattggctg atacgtgtcc cctcacctta aattgtgaca gaattgaaaa
     1741 taaaggaaaa gtttttgaca gtgaagtcat aataatcaca acaaaccttg ccaatccagc
     1801 cccactcgat tatgtcaact ttgaggcctg ttccaggaga attgatttcc tggtgtacgc
     1861 tgaggcacca gaagtagaaa aggcaaaacg ggactttcct ggtcagccag atatgtggaa
     1921 ggacgccttc aagccggact tttcacacat caagctacag cttgcacctc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa aggagtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgtgcatcag gcctactgca tgagaggatg gatgaatttg aactccaagg
     2101 tcctacaatc accaccttca atttcgaccg gaacagaatc acagcattca gacaattggc
     2161 tgcagaaaac aagtatggac tggtggatac catgaaagtt ggcaatcaat taaaaggagt
     2221 gaaaaccatg gaagagctca aacaagcaat caggaatgtg accatcaaga ggtgccggat
     2281 catctacggt ggctccacat atgaccttga atctgatggc aagggcaaag ttttggtgga
     2341 aaaggtcaag aacacctctg tacagaccaa caatgagatg gccggggccc tgcaccatct
     2401 caaacacgcc cgaatcaggt actatgtcaa atgtgtgcaa gaagcagtct attctatcat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga acatacaaga
     2521 actctggtcg aagccacaat tggatcaaaa tgaatcagag actaaggaag aggcccccaa
     2581 gtcagaagat gacgagttcg tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 gaaaaataaa actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggagtatctt caagacagag acaggtacta tgaggagctc gccattgcca aggccacgga
     2821 agaagacttc tgtgaagagg aggagatcaa aatccgtcag agaattttcc gtcctaccag
     2881 gaaacaaaga aaggaagaga gggccacatt agggctagta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acagaagtgt
     3001 tgactacaat gagaaactgg actttgaggc ccccccaagc atatggtcta ggattgtgag
     3061 cttcggttct ggctggggct tctgggtatc accaagcctg tttataacat caactcatgt
     3121 aatccccgca ggcataacag aagcatttgg agtccccatc aaacaaattc agatccacaa
     3181 atcaggtgag ttttgccgct tcagattccc aaaaccaatt agaccagatg tgacaggaat
     3241 gatcttggaa gaaggtgcgc ctgagggcac cgtggcaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat gggaacacac gcaaccatga gaattcaagg
     3361 ccgcatggtt ggcggacaga tgggtatgtt gctcactgga tcaaatgcta aaggaatgga
     3421 tttgggaaca actcctggtg actgtggctg tccttacatc tataaaaggg gcaatgacta
     3481 tatagtcatt ggggtgcaca ctgcagcagc ccgtggtgga aacaccgtca tctgtgccac
     3541 acagggaagt gagggcgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 ggcacccatt ctaggccctg ggggtgcacc aaaattgagc accaaaacca aattttggag
     3661 gtcatcgaac acgccccttc caccagggac atatgagcct gcctacctcg gcggccgtga
     3721 cccgcgtgtt aagggtgggc cctccttgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc aggggcaaac ctccaagacc aagtgtattg gaagcagcca aacaaaccat
     3841 catcaatgtc ctcgaacaaa ccctggaccc tccacaaaaa tggacatacg cacaggcgtg
     3901 tgcctcactt gacaaaacca cctccagcgg gcacccccat cacgtccgaa agaatgaatt
     3961 ctggaatggt gagaccttca ctggtaaatt ggcagaccaa gcatcaaaag caaacctaat
     4021 gtttgaggaa gggaaacaca tgacaccagt gtatacagca gcactcaagg acgagctagt
     4081 taagactgag aaaatctatg gaaagatcaa gaagagactg ctatggggct ctgatttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aggcacactg
     4201 catatcactc ccagtccgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatacaaat atcactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gtactggcag cagccttgga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggacctgct ggcccctagt gtagtagatg taggagactt
     4441 taaaatcaca ataaatgaag ggctcccctc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgtgc cttgtctgaa gtcaccaaac tatcccctga
     4561 cattatacag gcaaattcca tgttctcatt ttacggtgat gacgagattg tcagcaccga
     4621 cataaaattg gaccctgaac agttaaccac caaattgaag gagtacggcc tgaaaccaac
     4681 ccgcccagac aaaaccgagg gacccctgat catcagtgaa gacttgaacg gactcacttt
     4741 cctccgtagg acggtgactc gtgacccagc tggctggttt ggaaaactgg accaaagctc
     4801 aattttgagg cagatgtact ggactagagg accaaatcat gaagacccca atgagacaat
     4861 gataccccat tcccaaagac ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta aaatcagtaa attggtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc tatgttcagg tggatgaggt tttctgacct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatcgaat gatggtgcag ctagtctcgt accagaggcc attaatgaga
     5161 ctatgccatt ggaacccgtt gctggcgcat ctattgctgc cccagtggcg ggacaaacta
     5221 atataattga cccctggata agaacaaatt ttgtgcaagc ccctaatgga gaatttacag
     5281 tatcacccag aaattcccct ggagagattt tattaaattt agagttggga ccagatttga
     5341 acccttattt ggcccatcta tcaaggatgt acaatggata tgctggaggt gttgaggtgc
     5401 aagtgcttct tgctgggaac gcgttcacag caggaaagat attatttgca gcaatcccac
     5461 ccaactttcc tgtagatatg attagcccag ctcaaattac tatgctcccc catttgattg
     5521 tagatgttag gacattggaa cctattatga tacccttacc tgatgttagg aatgtgttct
     5581 atcattttaa taatcaaccc cagcctagga tgagattagt ggctatgctc tataccccat
     5641 tgagatctaa tggttcagga gatgatgttt tcactgtgtc ttgtagagtg ttgactaggc
     5701 caacccctga ttttgaattc atttacctag tgcctccctc tgtagagtcc aaaactaaac
     5761 cattcacact cccaatattg accatttctg aactaaccaa ttcccggttt cccatcccaa
     5821 ttgagcaact gtacacggcc ccaaatgaga ataatgttgt acagtgtcaa aatggaaggt
     5881 gcaccttgga tggagagctt cagggtacca cccagctgct atcaagtgca gtttgctctt
     5941 acaggggcag gactgtggct aacagtgggg acaattggga ccagaatttg ctccagctga
     6001 cctacccaag tggtgcaagc tatgacccca ctgatgaagt accagcaccc ttgggcaccc
     6061 aagatttcag tgggatattg tatggggtgt taacccaaga taatgtaagt gagggtacag
     6121 gggaggccaa aaatgctaag ggagtatata tttccaccac cagtggaaga tttaccccaa
     6181 aaattgggac aattggattg cattcaataa ctgaaaatgt gcaccccaat cagcaatcac
     6241 ggttcacccc cgttggggtc gctcagaatg aaaacacccc cttccagcaa tgggttctac
     6301 cacactacgc aggtgctctc gcactaaaca ccaatttggc acccgctgtt gccccgactt
     6361 tccctggtga gcaattgctg tttttcaggt cccgtgttcc atgtgttcaa ggtctgcagg
     6421 ggcaggatgc tttcatagac tgtctcctac ctcaagagtg ggtgaaccat ttttatcagg
     6481 aggctgctcc ctcccaagca gacgtcgccc tcatcaggta tgtcaaccct gatactggtc
     6541 gtactctgtt tgaggccaaa ctgcacaggt caggtttcat tactgtgtca cacactggtg
     6601 cctaccctct tgtggtcccc ccgaatggtc attttaggtt tgactcttgg gttaaccaat
     6661 tctactcact cgcccccatg ggaactggca atgggcgcag aagagttcaa taatggcagg
     6721 agcatttata gctggtctag ccggtgatat gctgacttct gctgttggtt cactgacctc
     6781 tgcaggagcc aatgccatca atcagaaatt aaattttgat tataacaaac aactccaaaa
     6841 tgcatccttt caacatgata aggaaatgtt gcaggcccaa attgatgcta caaagaagct
     6901 ccaatcagaa atgattgcaa tcaagcatgg ggttttgacc gcgggcggct tttccccagc
     6961 tgatgcagcc agaggggcag tcaacgcccc aatgactcga gtgttagatt ggtcagggac
     7021 acgctactac gctccaaatt ctgtgcaaac caccagttat tctgggcaat tcaccccctc
     7081 gccagtccat cgggcgcagg tgaagttccc ttctaattca tcccagcgga ctgcagctcc
     7141 aagcagtatc cgcagcctgt caacccaatc aacttcttta ggctccacct cctcaagggg
     7201 gtcctctgca gcctcctcta gttcgaggac agcagattgg gtgcaacaac agagggctct
     7261 tagcccgtac atgcagggag ccctgcagac ggcatacgtc acaccgccgt ctagtagggc
     7321 ttccagtatg agctctgtct caacagtgcc caaaggggtt ttggactcct ggacacctgt
     7381 gtttaacaca cgcaggcagc cgctgtttgc acacctcagg aagagggggg agtcacaggc
     7441 ttagtgaaaa ggataatcaa cttttaaaat gtgattttat tttcctttta aaaaaaaaaa
     7501 aaaaaaaaaa
//