Typing tool

Complete norovirus genomes

MG706448  GII.NA2
 GII.PNA2

Length: 7,525 | 3 CDS

ORF1: 5..5095
ORF2: 5076..6704
ORF3: 6704..7468
LOCUS       MG706448                7525 bp    RNA     linear   VRL 14-MAR-2018
DEFINITION  Norovirus GII isolate Hu/GII/PNV06929/2008/PER, complete genome.
ACCESSION   MG706448
VERSION     MG706448.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7525)
  AUTHORS   Tohma,K., Saito,M., Mayta,H., Zimic,M., Lepore,C.J.,
            Ford-Siltz,L.A., Gilman,R.H. and Parra,G.I.
  TITLE     Complete Genome Sequence of a Nontypeable GII Norovirus Detected in
            Peru
  JOURNAL   Genome Announc 6 (10), e00095-18 (2018)
   PUBMED   29519825
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7525)
  AUTHORS   Tohma,K., Saito,M., Lepore,C.J., Ford-Siltz,L.A., Gilman,R.H. and
            Parra,G.I.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-DEC-2017) CBER/OVRR/DVP/LHV, U.S. Food and Drug
            Administration, 10903 New Hampshire Avenue, Silver Spring, MD
            20993, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: High-performance Integrated Virtual
                                     Environment (HIVE) v. July 2017
            Sequencing Technology :: Illumina; Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7525
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.PNA4-GII.NA4/PNV06929/2008/PER"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Peru"
                     /collection_date="27-May-2008"
                     /note="genotype: GII.PNA4-GII.NA4"
     5'UTR           1..4
     CDS             5..5095
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AUX13648.1"
                     /translation="MKMASNDAATATAGTTSSNSEIHNKDVSNTQNIFANMTVGIKRA
                     LGARPKQPPPKPPSTKKEDKTTLPPIPPPPPNGEDIVITYNKQDDKVSGVPIVSTVET
                     SPLHDTAYSVPPLDQREKVDAKEPLTGSILEMWDGEIYHYGLYVEKGLVLGVHKPPSA
                     LSLARIELTPLSLYWRTVYTPPYLVAPDTLKKLHGESFPYTAFDNNCYTFCCWVLDLN
                     DSWLNRKCVSRTTGFYRPYQDWNRKPLPTMDESKLKKVANVFLCGLSSLFTRPIKDLV
                     GRLKPLNILNIVTNCDWTFPGVVEALILLAELFGIFWTPPDISAFVASLLGDYEMQGP
                     EDIATEIVPVVLGGIGMVLGFTKERIGRLLSSAASSLRACKEIGNYGIEVVKLVMKWF
                     FPTKNEVNEMEMVRAIEDAVLDFEAIENNHMTALLKDKNSLATFLRALDMEEEKARKL
                     STKSASPDIIGTINALLARLAAARSLVHRAKEEMSSRMRPVVIMISGRPGIGKTHLAR
                     DLAKKMAATLSGDQRVGLVPRNGVDHWDAYKGERIVLWDDYGMSNPVSDALRLQELAD
                     TCPLTLNCDRIENKGKVFDSDTIIITTNLSNPAPLDYVNFEACSRRIDFLVYADSPAV
                     DKAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTHSLIA
                     RATGLLHERLDEFDLQGPELPIYNFDQNKVASFRKLAADNKYGLMETIKAGNKLKEVK
                     TLDQFKEAVRDIRIKPCRIIYNSTAYDLESNGSGKVTVKKVGDQKVQANNELYSALNN
                     LRRARIRYYVKCFQEMIYSLLQIAGAAFVTSRMTQRMNVGKLWTKPERTMKAPTEPPA
                     PPIDDWTINPVDTIPEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERQGRYS
                     IEEYLQDRDRYYEELAIAKATEENFCEEEEVKIRQRIFRPTKKQRREERATLGLVTGS
                     EIRKRNPDDFKPKGKLWADDDRSVNYNERIDFEAPPSLWSRIVNFGSGWGFWVSSNLF
                     ITSTHVVPPGMTEAFGVPTSQIQIHRSGEFCKMRFPKAIRPDVSGMILEEGAPEGTVV
                     TILIKRTTGELMPLAARMGTHATMKIQGRMIGGQMGMLLTGSNAKNMDLGTVPGDCGC
                     PYVYKRGNDWVVIGVHTAAARGGNTVICATQGPDGEATLEGGDNHGTYCGAPIMGPGN
                     APKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTAPRGK
                     PPRPAVLEAAKETICSVLEQTIEPPQKWSYAQACASLDKTTSSGYPHHKKKNDNWNGE
                     SFTGVLADQASKANLMFEQGKHMQPVYTAALKDELVKTSKIYETIKKRLLWGSDLGTM
                     IRCARSFGGLMDEMKANCVRLPIRVGMNMNEDGPIIFEKHAKYRYHYDADYSRWDSTQ
                     QRHILGVALDIMVKFSAEPELSQVVSEDLLSPSVVDVGDFKITINEGLPSGVPCTSQW
                     NSIAHWLLTLCAMSEVSGLSPDVVQSNSCFSFYGDDEIVSTDIKLDPQKLTDKLREYG
                     LIPTRPDKTEGPLIIRESLEGLTFLRRDICRDPVGWYGKLDQSSIMRQLYWTKGPNHE
                     DPNETMIPHSQRPIQLMSLLGEAALHGPTFYKKVSKLVITELKEGGMDFYVPRQEPMY
                     RWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     mat_peptide     5..1000
                     /product="p48"
     mat_peptide     1001..2098
                     /product="NTPase"
     mat_peptide     2099..2635
                     /product="p22"
     mat_peptide     2636..3019
                     /product="VPg"
     mat_peptide     3020..3562
                     /product="Pro"
     mat_peptide     3563..5092
                     /product="RdRp"
     CDS             5076..6704
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AUX13646.1"
                     /translation="MKMASNDAAPSNDGAANLVPEANSEALALEPVAGGAIAAPLTGQ
                     TNIIDPWIMKNFVQAPNGEFTISPRNSPGEILLNLELGPEINPFLAHLSRMYNGFAGG
                     VEVQVLMAGNAFTAGKVIFAAVPPHFPVENISPPQITMFPHIIVDVRTLEPIFIPVPD
                     VRNNFFHYNQMNDPKMRLIAMLYTPLRSNGSSDDVFTVSCRVLTRPTPDFEFNYLVPP
                     TVESRTKPFSVPILTIGEMTNSRFPLPIDMLYTSPTDSLVVQPQNGRCTIEGELQGTT
                     QLVTPNICSLRGAITGHEGNDDNHKWHMTVTSPNGAAFDPTEDVPAPLGTPDFIADIY
                     GVLSQRNRSIESGQSGPANRSHEAVVSTRSPKFTPKLGSVMIATWNTNDIELEPTKFT
                     PIGLENPGPFQQWRLPNYSGALTLNMGLASSVFPTYPGEQILFFRSYIPLKGGFGNTA
                     IDCLVPQEWVQHFYQESAPAQSDVALLRYVNPETGRVLFEAKLHRQGFLTVARSGESP
                     INVPANGYFRFDSWVNQFYSLAPMGTGNGRRRFQ"
     CDS             6704..7468
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AUX13647.1"
                     /translation="MAGAFLAGLAGDIVTNSVGSLVNAGASAINQKIDFENNKYLQGE
                     SFKHDKEMLNAQIEATKKLQMDMINIKQGVLSAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPNAPVTTSLSGGFTGQAVHRPTPNFGSNQIPKTMSSRGTSVRSNSTQLTSLGS
                     QSSGSSRSSVTTVSSSLPSTNRTREWVNQQNLNLEPHLPGSLRTAFVTPPSSTASSSG
                     TVSTVPKGVLDSWTSAFNTRRQPLFAHLRRRGESNV"
     3'UTR           7469..7525
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctgc cactgcgacc gctggcacaa ccagctcaaa
       61 cagtgaaatt cacaacaaag atgttagtaa cacacaaaac atctttgcca acatgactgt
      121 tggcataaag agggctctgg gggcgaggcc aaaacaacct ccccccaagc ccccttccac
      181 aaagaaggag gacaaaacca cccttcctcc aatacccccc ccacccccca atggtgagga
      241 cattgtcatc acgtacaaca agcaagatga caaggtcagt ggagttccca tcgtttccac
      301 tgttgagaca tcccctctgc atgacaccgc atacagtgtc cctcccctgg atcaaaggga
      361 aaaggttgat gcaaaggagc ccctaacagg ttcaatactc gagatgtggg atggtgagat
      421 ctaccactac ggcctctatg tggagaaggg tttggtcctc ggcgtgcaca agccaccatc
      481 cgccttgagc ctggcacgca tagagttaac ccccctctct ctctactgga ggacagtcta
      541 tacaccaccc tacctagtgg ctccagacac cctcaagaaa ctccacgggg aatcattccc
      601 ctacacggct tttgacaaca actgctacac cttttgctgt tgggtcttag acctaaacga
      661 ctcatggctt aataggaaat gtgtatcaag gactactggc ttctacagac cctaccagga
      721 ttggaataga aaacccctac caaccatgga tgagagtaaa ctcaaaaagg tggccaatgt
      781 gtttctgtgt ggtctatcca gcttattcac caggcctatt aaggacctcg taggtagact
      841 caaaccattg aacatcctca acattgtcac caactgtgat tggactttcc ccggtgttgt
      901 agaagctctc atcctactgg cagaactctt tggcattttc tggaccccac cggacatatc
      961 cgctttcgta gcctccctgt tgggcgacta cgagatgcaa gggcctgagg acattgcaac
     1021 cgagatcgtg ccagttgttc tcggtggtat tggcatggtc cttggtttca ccaaagagag
     1081 gattggccga ctactgagtt cagctgcatc atcactcagg gcatgcaagg agattggcaa
     1141 ctacgggata gaggtggtca aattggtgat gaaatggttc tttcccacca aaaatgaagt
     1201 gaatgaaatg gagatggtta gggcgataga agatgcggta cttgacttcg aggcaataga
     1261 aaacaaccat atgacagccc tgctcaaaga caagaacagc ctagccactt tcctcagagc
     1321 actagacatg gaggaggaga aagcgcggaa attgtcaacc aaatccgcgt caccagacat
     1381 aatcggtacc ataaacgccc ttctagccag gctcgccgcc gctagatccc tagtccacag
     1441 ggccaaggaa gagatgtcat ccaggatgcg tcctgttgtc attatgattt ctggccgacc
     1501 cggaataggg aagacacacc ttgcacgcga cctggctaag aagatggcag caaccctctc
     1561 aggtgaccag agagtgggcc ttgtaccaag aaacggtgtc gatcactggg atgcatacaa
     1621 aggagagaga atcgtgctct gggatgatta tggcatgagc aaccccgtgt ctgatgccct
     1681 acggctccaa gaacttgccg acacatgccc cctaacactt aattgtgaca ggatagagaa
     1741 caaagggaaa gtctttgata gtgataccat aatcataaca accaatctgt caaacccagc
     1801 tccacttgat tatgtaaact ttgaagcttg ctcccgccgc attgacttcc tcgtctatgc
     1861 ggattcccct gcagttgaca aagcaaagag ggatttccct ggtcaaccag acatgtggaa
     1921 ggatgcattc aaatcagact tctcccacat aaaattacaa ttggcaccac aaggaggttt
     1981 cgacaaaaat ggcaacaccc cacatggtaa aggagtcatg aagaccctaa ccacacactc
     2041 tctcatagcc agggctactg gtttgttgca tgagagactg gatgaatttg atctacaagg
     2101 tccagaattg cccatataca attttgacca gaacaaggtg gcttccttta ggaagctggc
     2161 tgcagacaac aagtatggtc tcatggaaac cataaaagca ggtaacaagt tgaaggaagt
     2221 caagacactg gatcaattca aagaggccgt gagggacata cgcataaagc cttgcagaat
     2281 aatctacaat tccacagctt atgacctgga gtctaacggc tcagggaagg tcactgtcaa
     2341 gaaagtagga gaccaaaaag tccaagccaa caatgagctc tactctgccc tcaacaacct
     2401 gcgtagagcc aggattagat actatgtcaa gtgtttccaa gaaatgatct actcactcct
     2461 ccaaatagcc ggtgcggctt ttgtcacatc gagaatgaca caaaggatga atgttggcaa
     2521 gctgtggacc aagccggaga gaactatgaa ggcccccacg gagccccctg ctcctccaat
     2581 tgatgattgg accataaacc cagttgacac aattccggaa ggtaagaaag gcaagaacaa
     2641 aagtggtaga gggaagaaac acactgcctt ctccagcaaa ggtctcagtg atgaggagta
     2701 cgatgaatac aagaggatca gagaggaacg tcaaggaagg tactccatag aagaatactt
     2761 gcaggacaga gaccgctatt atgaagaatt ggctatagcc aaagcaacag aggaaaattt
     2821 ctgtgaagag gaagaagtca aaataaggca aaggatcttc aggccaacca agaaacaacg
     2881 cagggaagaa agagccaccc tgggactggt cacaggcagt gaaatcagga aaaggaaccc
     2941 agatgacttc aaaccaaagg gaaagctgtg ggctgatgat gaccgtagcg ttaactacaa
     3001 tgaaaggata gattttgaag ccccccctag tctatggtct agaatagtta attttggttc
     3061 aggttggggt ttctgggtct cttccaacct cttcatcacc tccacacatg ttgttccacc
     3121 aggcatgacg gaggcttttg gagtcccaac aagccaaatc caaattcaca ggagtgggga
     3181 attttgcaag atgagattcc ccaaagccat cagacctgat gtctctggaa tgattcttga
     3241 ggaaggcgca cccgaaggga cggtggtgac catactgatc aagagaacca ctggagagct
     3301 catgccactg gcagcccgta tgggcaccca tgccaccatg aagatacagg ggaggatgat
     3361 tgggggccaa atggggatgc ttctcacagg gtccaatgcc aaaaatatgg accttggtac
     3421 cgtccccgga gattgtggct gtccttatgt ctacaaaagg ggtaatgatt gggttgtcat
     3481 tggggtgcac accgccgctg caaggggtgg caacacggtg atatgtgcaa ctcagggacc
     3541 agatggagaa gccacacttg agggaggaga caatcacggt acttactgtg gcgcaccaat
     3601 catgggacca ggaaatgccc caaaactcag caccaaaacc aaattctgga gatcttccaa
     3661 tgccccactt ccccctggca catatgaacc tgcctatctt ggtggtagag accccagggt
     3721 taaaggtggc ccatcactac aacaagtcat gagagaccaa ctcaaaccct tcaccgctcc
     3781 ccgtgggaag ccgccaaggc cggcagttct agaggccgct aaggagacca tctgtagcgt
     3841 acttgagcaa accatagaac caccccaaaa gtggtcctat gcgcaagcct gtgcttccct
     3901 ggacaagaca acatcaagtg gctaccccca ccacaagaag aagaatgata actggaatgg
     3961 agagtctttc actggcgtcc tggctgacca ggcatcaaaa gcaaatctca tgtttgagca
     4021 agggaaacac atgcagcctg tgtatacagc tgcacttaag gatgaacttg tcaagaccag
     4081 taagatctat gaaaccatca agaaaaggct cttgtggggt tctgacctgg gcacgatgat
     4141 tcgttgtgca agatcatttg ggggtctcat ggatgagatg aaggctaact gtgtgagatt
     4201 gcccatcagg gtcgggatga acatgaatga agatggacct ataatctttg agaaacatgc
     4261 aaaatataga tatcattatg atgctgatta ttccaggtgg gactcaaccc aacagagaca
     4321 catactgggt gttgcacttg acatcatggt taaattctca gctgaaccag aactatcaca
     4381 agtggtgtct gaggatcttc tgtcacccag tgtcgtggat gttggtgact ttaagatcac
     4441 aataaacgag ggccttccct caggtgtccc atgcacatct caatggaact caattgctca
     4501 ttggcttcta acactgtgtg ccatgtcgga agtctctgga ctctcccccg acgtggtaca
     4561 atcaaattca tgtttctcct tctatgggga tgatgagata gtcagcacag acataaagtt
     4621 ggacccacaa aaactgacag acaaactgag agagtatggg ctcattccaa cccgacctga
     4681 taaaacagag gggccactca taattagaga gagcttagag ggtctgacgt tcctcaggag
     4741 agatatatgt agggacccag tcggctggta tggtaagctt gaccagtcct caatcatgag
     4801 acaactgtat tggaccaaag gacccaacca tgaggatccc aatgaaacaa tgattccaca
     4861 ttctcaaaga ccaatacaat taatgtccct tctcggtgag gctgccctgc atggaccaac
     4921 attttacaag aaagttagca aattggtaat cactgaactc aaagaaggtg gaatggattt
     4981 ttacgtgccc agacaagaac caatgtacag gtggatgaga ttctccgact tgagcacgtg
     5041 ggagggtgat cgcaatcttg ctcccgaagg tgtgaatgaa gatggcgtcg aatgacgccg
     5101 ctccatctaa tgatggtgct gccaacctcg ttccagaggc caactcagag gcattggcat
     5161 tggaaccggt ggcaggtggg gctattgccg cacctctcac tggtcaaaca aatataattg
     5221 acccctggat tatgaaaaac tttgtgcagg cacctaatgg tgaattcaca atatccccaa
     5281 gaaattcccc tggagaaatt ttgttaaacc ttgagttagg accagaaatt aatccttttc
     5341 ttgcccactt atctaggatg tataatgggt ttgctggggg agtggaggta caggtgctca
     5401 tggctggcaa tgcattcact gcaggaaagg tcatatttgc ggctgtgccg cctcatttcc
     5461 cagtagaaaa cattagtccc ccacagataa ctatgttccc ccacataata gttgatgtta
     5521 ggactcttga accaattttt atccctgtcc cagatgtgag aaataatttc tttcattaca
     5581 atcaaatgaa tgatccaaag atgaggttaa ttgctatgct gtacaccccc ttaagatcaa
     5641 atggttcttc tgatgatgtt ttcactgtgt cttgtagagt tctcaccaga cccacccctg
     5701 attttgagtt caattatttg gtaccaccca ctgtcgagtc aaggacaaaa cccttcagtg
     5761 tgcccatcct aacaattgga gagatgacaa attctaggtt cccattacct attgacatgc
     5821 tgtacaccag cccgactgac agtttggtcg tccaacctca aaatggcagg tgcacaattg
     5881 aaggtgaatt gcaaggtaca actcaattgg tgactccaaa catttgttcc cttcgaggcg
     5941 caatcaccgg gcatgaaggc aatgatgaca accacaaatg gcacatgaca gtcacgagcc
     6001 ctaatggtgc cgcctttgac ccaacagagg atgtgcctgc ccccctgggc actccagatt
     6061 tcatagctga catatatggg gttctctccc agagaaatag atccatcgaa tctggccaga
     6121 gtggtcctgc aaatagatct catgaggctg ttgtctccac acggagtcct aaatttaccc
     6181 ctaaattagg ttcagtaatg attgccactt ggaacaccaa tgatattgaa cttgagccca
     6241 ccaaattcac acctataggt cttgagaatc ccggcccctt tcaacaatgg cggctaccaa
     6301 attactcagg agccctaaca ctcaacatgg gacttgcatc atctgtattc ccaacatacc
     6361 ctggtgaaca aattcttttc ttccgttcat acattcccct caaaggtggc tttggaaaca
     6421 cagccataga ttgccttgta ccacaggaat gggtccagca cttctatcag gaatcagccc
     6481 ctgcacaatc agatgtggca ctacttaggt atgtgaaccc tgagacagga cgtgtcctgt
     6541 ttgaggccaa actgcacaga caaggtttcc ttacagttgc tagatcaggt gaaagtccca
     6601 tcaatgttcc tgccaacggt tatttcagat ttgactcttg ggttaaccaa ttctactctc
     6661 ttgcccccat gggaactggg aacgggcgca gaaggtttca gtaatggcag gagctttctt
     6721 agcaggattg gctggtgaca tagtcacaaa tagtgtaggt tctttagtta atgcaggagc
     6781 tagtgcaatc aaccagaaaa ttgattttga aaataataaa taccttcaag gagaatcttt
     6841 taaacatgat aaagaaatgc tgaatgcaca aattgaggct acaaagaaat tgcagatgga
     6901 tatgataaac atcaaacaag gagttctttc agctgggggg ttctcaccca ctgatgcggc
     6961 tcgtggagcc atcaacgctc ctatgacaaa ggttctggat tggaatggga ctagatactg
     7021 ggcacccaat gctcctgtaa caacatcact gtctggtggc ttcactgggc aggccgtaca
     7081 caggcccaca ccaaattttg gcagcaatca aatcccaaag acaatgtcca gtaggggaac
     7141 atctgtgaga tcaaattcaa ctcaattgac cagtctgggt tcccaatctt ctggttcctc
     7201 ccgaagcagt gtgactaccg tgagtagctc attgccttca accaacagga ctagagagtg
     7261 ggtgaaccaa caaaatctca atttggaacc tcacctacct ggatcactga ggacagcctt
     7321 tgtcactcca ccatcgagca ccgcttccag ctcaggcaca gtctcaaccg tgcccaaagg
     7381 tgttttggac tcctggacat ctgcattcaa cacacgcaga cagccgctgt ttgcacacct
     7441 tcgtagaagg ggggagtcaa atgtttagtg aaaagattat ttaattagaa ctaatttcaa
     7501 tttggactaa ttcggaaaat ctttt
//