Typing tool

Complete norovirus genomes

MG692610  GII.17
 GII.P17

Length: 7,556 | 3 CDS

ORF1: 5..5113
ORF2: 5094..6716
ORF3: 6716..7495
LOCUS       MG692610                7556 bp    RNA     linear   VRL 01-DEC-2018
DEFINITION  Norovirus GII isolate NS2014603, complete genome.
ACCESSION   MG692610
VERSION     MG692610.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7556)
  AUTHORS   Chen,L.
  TITLE     Complete genome analysis of a novel norovirus GII.17 identified in
            China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7556)
  AUTHORS   Chen,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2017) Microbiology laboratory, Huzhou Center For
            Disease Control and Prevention, 999 changxing Road, Huzhou,
            Zhejiang 313000, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7556
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="NS2014603"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China: Huzhou"
                     /collection_date="Oct-2014"
                     /note="genotype: GII.17"
     CDS             5..5113
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AUW27287.1"
                     /translation="MKMASNDASAAVAGKNNNNDKEKSSSDSLFANMSVTFKKALGAR
                     SKQPPPGETKQTQKPPRPPTPELVKRIPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVV
                     QPDAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPA
                     AISLAKIEITPLSLYWRVVYTPQYLIDPGTLKNLSGETFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRMIQRTTGFFKPYQDWNRKPLPTMDEPKIKKAANAVLCALSSLFTRPIKDI
                     IGKLRPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQG
                     PEDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKW
                     FFPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARK
                     LSTKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLA
                     RELAKKVASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     IEKAKRDFPGQPDMWKDHFRPDFSHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLI
                     ARASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSV
                     KTLDELKQAIKNISIKKCQIVYNGCTYTMESDGRGKVVVEKVQNATVQTNNELVGALH
                     HLRSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDEPEDR
                     GGCPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREE
                     RNGKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATL
                     GLVTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFW
                     VSPSLFITSTHVIPKGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGA
                     PEGTVVSILIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTT
                     PGDCGCPYIYKRGNDLVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKN
                     DYWSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWG
                     SDLSTMIRCARAFGGLMDEFKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYS
                     RWDSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYVDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWT
                     RGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVP
                     RQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     5..1003
                     /product="p48"
     mat_peptide     1004..2101
                     /product="NTPase"
     mat_peptide     2102..2638
                     /product="p22"
     mat_peptide     2639..3037
                     /product="VPg"
     mat_peptide     3038..3580
                     /product="Pro"
     mat_peptide     3581..5110
                     /product="RdRp"
     CDS             5094..6716
                     /note="ORF2; major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AUW27288.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLPTGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
                     VSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
                     DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
                     CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV
                     VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     CDS             6716..7495
                     /note="ORF3; minor structural protein; minor capsid
                     protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AUW27289.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDKEMLQAQVRATKQLQSEMIALKQGVLAAGGFSPTDAARGSIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMSSPNAPQSKPAKPRSLAPSSSSSSVYSMYTQST
                     HLTSGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgtt gctggcaaaa acaacaacaa
       61 cgacaaggaa aaatcttcaa gtgacagctt gtttgctaac atgtctgtca cttttaagaa
      121 agccctcggg gcgcggtcta aacaaccgcc cccgggagaa acaaaacaaa cacaaaaacc
      181 accaaggcca ccgacaccgg aattggtgaa gagaatacct ccacccccac ccaatggcga
      241 ggatgaacca gggatagtgt acaaggtggg agagggtgtg tctgggctgc ccgacctaac
      301 aactgtggta caacctgacg cacaaaacac agcttatagt gttcccccac ttagccagag
      361 agaagtcggc gaagctaaag aaccgctgcc tggctccatt ctggaaatgt gggatggtga
      421 gatctaccac tatgggctgt atgttgagcg ggggcatgtg ctcggagtac acaaaccacc
      481 tgctgcaata agccttgcca aaattgaaat aacaccgctg tctctctact ggagagtggt
      541 ctacactccc cagtatttga tagatccagg aactcttaag aacttgagtg gagagacttt
      601 cccatacacg gcctttgaca acaactgtta tgccttctgt tgttgggtcc tagacctcaa
      661 cgactcctgg cttagcagga gaatgatcca aagaacaact ggattcttca aaccttatca
      721 ggattggaac agaaaaccct taccaaccat ggatgaaccg aaaatcaaga aggccgcgaa
      781 tgctgtccta tgcgctctct cctcactctt cactagaccc attaaggaca tcattggaaa
      841 gcttagacca ctgaacattc ttaatatact ggcaacctgc gattggactt ttgcaggcat
      901 agtggaatcc ttgatccttc ttgctgaact ctttggggtg ttctggacac ccccagatgt
      961 gtctgcgatg attgctccct tactcggtga ctacgagatg caaggccccg aagacctggc
     1021 cgtggaactt gtgcccgtag tgatgggagg aataggtttg gtgttaggat tcaccaaaga
     1081 aaagatcggc aagatgcttt catcagctgc gaccacactt agggcctgca aggatctagg
     1141 atcttatgga ttggagatac tcaaattggt catgaagtgg ttcttcccca agaaggagga
     1201 ggctaacgaa ctagccatgg tgagggccat tgaggatgca gtcctggatt tggaggcaat
     1261 agaaaacaat cacatgacca cccttctcaa ggataaagac agcctggcca catacatgag
     1321 gactcttgac ttggaagaag agaaagcaag gaaactgtca accaaatcgg cgtcacctga
     1381 catcgtgggt acaataaacg cattattggc taggatagca gccgccaggt cactggtcca
     1441 caaggctaag gaggagctct cgagcagaca gagacctgtt gttgtaatga tatcaggtag
     1501 accaggtata ggaaagaccc atctggccag agagctagcc aagaaagttg cgtcaacact
     1561 gtcaggcgac caaaggattg gactggtacc tagaaatggc gtcgaccatt gggacgccta
     1621 caagggagaa agggtggttc tgtgggatga ttatggtatg agcaacccta tacaggacgc
     1681 actgaggctc caagaattgg ctgacacctg tcctctgacc ctaaattgtg ataggattga
     1741 aaacaaagga aaagtgttcg acagtgatgc cataattata acaaccaacc ttgcaaaccc
     1801 agcaccacta gactatgtca actttgaggc ctgctctaga cgcatagact tcttggtgta
     1861 tgcagacgca cctgacattg agaaggctaa gcgtgacttc cctggccaac cagatatgtg
     1921 gaaagaccat ttcagaccag acttctcaca cattaaactt cagctggcac cacagggagg
     1981 ttttgacaaa aatggcaaca ccccacatgg caaaggtgtg gtgaagtccc tgacgattgg
     2041 ttctctgatc gccagggcct ccggcttgct ccacgagaga atggatgaat tcgagctcca
     2101 aggctctgac ctgccaacct tcaattttga ccgcaacaaa gtcgccgcct tcagacaatt
     2161 agcagctgaa aacaaatatg gtcttatgga cacattgagg gtcggcaacc aactgaaaag
     2221 tgttaagacc ctggatgagc tgaagcaggc cataaagaac atcagtatca agaagtgtca
     2281 gatagtgtat aatggatgca cctataccat ggaatctgat gggaggggca aggttgtggt
     2341 tgaaaaggta caaaacgcaa cagttcaaac caacaatgaa cttgtagggg cgctccacca
     2401 cctgagatct gcaaggataa gatactatgt taaatgtttc caagaagcca tttactctct
     2461 actccaaatt gctggtgcag ccttcgtcac ctcacgcatc gtgaggcgca tgaacatatc
     2521 aaacctctgg tcgaagccac ccatcgagga gggtgatgag cctgaagaca gaggaggatg
     2581 ccccaagccc agggatgaag atgacctcac tattgactct agagacatta aagtggaagg
     2641 gaagaagggc aagaacaagt ctggccgggg caagaaacac acagccttct cttccaaggg
     2701 cctcagtgat gaagagtacg atgagtacaa gagaatcaga gaggagagga atggcaaata
     2761 ctcaatagag gaatacctcc aagataggga cagatactat gaagagcttg ccattgctaa
     2821 ggccactgag gaggacttct gtgaggagga ggagatcaaa atccgccaga gaatcttccg
     2881 acccaccagg aagcagcgga aagaggaaag ggccacgctt gggcttgtca caggatcgga
     2941 aatcagaaag aggaatccag atgactttaa accaaaagga aaattgtggg ctgatgacaa
     3001 caggagcgtg gattacaatg agaggataga ttttgaggct cccccgagtg tttggtctag
     3061 gatagtcaac tttggcacag gctggggatt ctgggtttct ccaagtctct ttataacttc
     3121 aacacacgtc ataccaaaag gaatcactga ggcctttgga gtgcccataa accaaatcca
     3181 aattcacaaa tctggagaat tttgccgctt gcggtttcca aagccaatta gaccagacgt
     3241 gagtgggatg atcttggaag agggcgcccc tgaaggcact gttgtgtcta ttctcatcaa
     3301 aaggacaaca ggggagctga tgcctcttgc agtcagaatg gggactcatg ccacaatgaa
     3361 aatccaaggt agaacggtgg gtggtcagat gggtatgctt ctcactggct caaatgctaa
     3421 aagcatggat ctaggcacaa cgccaggtga ctgcggatgt ccatacatat acaaaagggg
     3481 caatgacctt gtggtcattg gggtgcacac tgcagcagct cgtggaggca acacggtcat
     3541 atgtgccaca cagggaagtg aaggtgaagc cactcttgaa ggaggtgaca acaagggtac
     3601 ctattgtgga gcccccattt tgggacctgg caatgcacca aaattgagca caaagacaaa
     3661 attctggaga tcctctaacg caccgcttcc cccaggtact tatgaaccag cataccttgg
     3721 tgggagagac ccgcgcgtga agggaggccc atctctgcaa caagttatga gagaccaact
     3781 taaacctttt acagagccca gagggaagcc accaaaccca aatgtcttag agtcagcaaa
     3841 gaagactatc atcaatgttc tggaacaaac cattgacccc cctcaaaagt ggtcatatgc
     3901 ccaagcttgt gcatcccttg acaagacaac ctccagtgga tacccgcacc acgtccggaa
     3961 gaatgactat tggagtggtg aatccttcac aggaaaactt gcagatcagg cttcaaaagc
     4021 aaatctcatg tatgaggaag gcaagcacat gcaaccagtt tacaccgcag cactcaaaga
     4081 cgagctcgtg aaaactgaca aaatttatgg caaaatcaag aaaagactcc tgtggggttc
     4141 tgacctctcc acaatgattc gatgcgccag agcatttggt ggtctcatgg atgaattcaa
     4201 agcaaattgt attacactcc ctatcagagt tggtatgaat atgaatgaag atggtcccat
     4261 aatatttgag aaacactcca ggtacaggta ccactatgat gctgattact cccgctggga
     4321 ctccacacaa cagcgggcag tgctggaagc ggcacttgaa atcatggtga gattttctgc
     4381 tgagccacag ctggcacaaa tagtggcaga ggacctgctg tcaccaagtg tggttgatgt
     4441 gggcgatttc aaaatcgcta tcaatgaagg cctaccatct ggcgtgcctt gcacctcaca
     4501 atggaattct attgcccact ggttacttac cttgtgtgcc ctttctgaag tgacaggatt
     4561 aggtcctgac atcatacaag ctaactccat gtactctttc tatgttgatg atgagattgt
     4621 gagcacagac ataaaattgg acccagagaa attgaccgca aagctcaaag aatatggcct
     4681 taaacccact cggcccgaca aaactgaggg gccgttggtg attagtgagg acctgaatgg
     4741 gttgactttc ctccgccgaa cagtcacccg tgatccagca ggttggtttg gaaagttgga
     4801 ccaaaactcc atcctcaggc agttgtactg gacaagagga cccaaccatg aagaccccag
     4861 tgagaccatg ataccacacg cacaaagacc tgtgcagctc atggcactac taggagaatc
     4921 ctccctacat ggaccctcat tttacagcaa ggttagcaaa ttagtcatat ctgaacttaa
     4981 agagggagga atggattttt atgtgcccag acaagagtca atgttcagat ggatgagatt
     5041 ctcagatcta agcacatggg agggcgatcg caatctggct cccagttttg tgaatgaaga
     5101 tggcgtcgaa tgacgccgct ccatctaatg atggtgctgc tggtctcgta ccagagggca
     5161 acaacgagac ccttccccta gaaccagttg cgggcgcagc tatagccgca cccgtcactg
     5221 gccaaaataa tataattgac ccctggatta gaacaaattt tgtgcaagca ccaaatggag
     5281 agttcacagt gtcacccaga aactctcctg gagaaatttt attaaactta gagttgggcc
     5341 ctgatttgaa cccttatttg gctcatttgt caaggatgta caatgggtat gctggtggag
     5401 tggaagttca ggttctcctg gcagggaacg cgttcactgc cggaaagatc ctcttcgccg
     5461 ccgtcccgcc aaatttccca gtggaattct taagcccagc ccagatcaca atgctcccac
     5521 atttaatagt agatgttagg actcttgaac caattatgat cccactccct gatgttagga
     5581 atacattctt ccattatagt aaccagccta acagccgcat gagattagtg gctatgctct
     5641 ataccccact cagatctaat ggctcaggtg atgatgtctt tactgtctct tgcagggttt
     5701 tgactaggcc tactcctgat tttgagttca cttatttagt gccaccttct gttgaatcta
     5761 aaactaagcc tttttcctta cctattttaa ccctttctga gctcacaaat tcgaggtttc
     5821 cagtccccat cgattcgctt ttcaccgccc agaataatgt gttgcaggtg cagtgtcaaa
     5881 atggcaggtg tacacttgat ggtgagttac aaggcacaac ccagttgctc ccaactggca
     5941 tctgtgcatt cagaggacgg gtgacagcac aaattaacca acgtgacagg tggcacatgc
     6001 aactgcaaaa cctcaatggt acaacatatg acccaactga tgatgtgcca gccccgctgg
     6061 gtacacctga cttcaagggc gtcgtgtttg ggatggtaag ccaaagaaat gtgggtaatg
     6121 atgcgcctgg ctcaaccaga gcccaacagg cgtgggtttc aacctatagc ccccaatttg
     6181 tccccaaatt aggttctgtc aatcttagaa ttagtgataa tgatgatttc caattccagc
     6241 cgacaaaatt cacaccagtg ggcgtcaatg atgacgatga tggccacccg ttcagacaat
     6301 gggaactacc aaactattca ggggagctta ccttgaatat gaatcttgcc cccccagttg
     6361 ctccaaattt tcctggtgaa caattgttat tcttcagatc tttcgtgcca tgctcaggag
     6421 gttacaacca aggtattata gattgtctta ttccccaaga atggatccaa cacttctatc
     6481 aggaatcagc accctcccag tcagacgtgg ccctaatcag gtatgtcaac cccgatacgg
     6541 gacgtacact gtttgaagca aaattgcaca gatctggtta cattactgtg gctcactctg
     6601 gagactatcc tcttgttgtt ccggctaatg gacactttag atttgattct tgggtaaatc
     6661 agttttactc actcgcccca atgggaactg ggaatgggcg aaggagggct cagtaatggc
     6721 tggggctttc attgcaggat tggcaggcga catgctcacg tcatctgtgg gctcccttgt
     6781 gaacgcaggg gcaaacgcca tcaaccaaaa gatagacttt gaaaacaaca aacaactcca
     6841 gtctgcttcc tttcagcatg ataaagagat gctccaagcg caggtgaggg caaccaagca
     6901 gctgcaatct gaaatgatag ccctaaaaca gggggttttg gccgcaggcg gcttttcccc
     6961 cactgatgca gcaaggggat ccattggtgc acccatgaca aaggtgcttg actggtctgg
     7021 cactcgatac tgggcgccca attccacaaa gacaactggc tattcgggac aattcacctc
     7081 ttcacctgtg catatgtcta gcccaaatgc tccacaatca aaacctgcaa agcctaggtc
     7141 tctagctcct tcctcttctt ctagcagtgt ctatagtatg tatactcaat ctactcattt
     7201 aacatctggc tcttctagta atgcttcttc tgcctccaca aaattgacaa atttaagctc
     7261 tggctcctct caaaacagaa cagcagagtg ggtaaatcaa cagagaagtc ttagcccttt
     7321 catgagtggc gcacttaaca tctcacatgt cacgccaccc tcaagtaggg cttccagttc
     7381 tgggacggtc tcgaccgtgc ccaaggaagt tttggactcc tggacgtctg cgtttaacac
     7441 acacagacag ccgctcttcg cacacctcag agtgaggggg gagtcacgtg tttagtgaaa
     7501 agaaataatt ggctataatg tgatttcttt ctaattttgg ctaatttgta tctttt
//