Typing tool

Complete norovirus genomes

MG601447  GII.3
 GII.P12

Length: 7,556 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6731
ORF3: 6731..7495
LOCUS       MG601447                7556 bp    RNA     linear   VRL 28-JUL-2018
DEFINITION  Norovirus GII isolate HNZZ0909, complete genome.
ACCESSION   MG601447
VERSION     MG601447.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7556)
  AUTHORS   Huo,Y., Liu,J., Zheng,L. and Wang,Y.
  TITLE     Genomic and biochemical characterization of GII.3 Norovirus
            isolated from children of Zhengzhou city, Henan province, China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7556)
  AUTHORS   Huo,Y., Liu,J., Zheng,L. and Wang,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2017) Center for Translational Medicine, The
            Sixth People's Hospital of Zhengzhou, Jingguang Road No. 29,
            Zhengzhou, Henan 450000, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7556
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="HNZZ0909"
                     /db_xref="taxon:122929"
                     /note="type: GII.3"
     CDS             5..5104
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AXF54259.1"
                     /translation="MKMASNDASAAAAAYSNNDNAKSSSDGVLSSMAVTFKRALGARQ
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVWQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     SELKQALKNVAIKSCQIVYGGCTYRLESDGKGDVKVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEEIASKDGC
                     PKPQDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGRPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6731
                     /codon_start=1
                     /product="VP1 protein"
                     /protein_id="AXF54260.1"
                     /translation="MKMASNDATPSNDGAAGLVPEINNEAMALDPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLVAMLYTPLRANNSGDDVFTVSCRVLTRPSPEFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDHADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTAGRFTPKLGSLEISTESGDFDQNQP
                     TRFTPVGIGVDHESDFQQWSLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRVQ"
     CDS             6731..7495
                     /codon_start=1
                     /product="VP2 protein"
                     /protein_id="AXF54261.1"
                     /translation="MAGAFIAGLAGDILTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKALDWNG
                     TRYWAPSATSTTSMSGGFTNQAVHRTTPNFKMNQAPRSTPSSGSSVRSLSTQVTSLSS
                     HSSGSSRPSGSTVASSLPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSLG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgcttata gcaacaacga
       61 caacgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcaaaaac agcctccccc gagggaaata ccacaaaggc ctccacggcc
      181 acccacccca gaactggtca aaaagatccc tcctccccca cccaatgggg aggatgaact
      241 agtggtctct tatagcgcca aagatggcgt ttctggtttg cctgaactta ccactgtctg
      301 gcaaccggat gagaccaaca cggcattcag tgttccccct ctcaaccaga gggagaacag
      361 ggacgccaag gagccgctga ccggaacaat tctggaaatg tgggacgggg agatctatca
      421 ttatggtctg tatgtggagc gaggccttgt acttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggttgaac tagcaccact ctctctgttt tggaggccag tgtacacacc
      541 acagtatctc atctctccag acactcttag gagactgcat ggagagtcgt tcccctacac
      601 agcctttgat aacaactgct atgccttctg ttgttgggtt ctggacctaa acgactcgtg
      661 gttgtgcagg agaatgatcc agagaacaac tggcttcttc agaccttacc aagaatggaa
      721 caggaaaccc ctccccacca tggatgactc taaattgaag aaggtagcca acatattctt
      781 gtgtgcgcta tcttcgctat tcactaggcc catcaaagac ataataggaa aggtgagacc
      841 gctcaacatc cttaacatcc tggcctcatg tgattggact tttgcaggca tagtggaatc
      901 tttgatcctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactaggtg actacgaact gcaggggcct gaggaccttg cagtggaact
     1021 cgtaccagta gtgatgggag ggattggttt ggtgttagga ttcaccaaag agaagatcgg
     1081 aaaaatgttg tcatccgctg cttccacctt aagagcttgt aaagaccttg gtgcatacgg
     1141 gctggaaatc ctaaaattgg tcatgaaatg gttcttccca aagaaagagg aagcaaatga
     1201 gctagctatg gtgaggtcca tcgaggatgc ggtgctggac ctcgaagcaa ttgagaacaa
     1261 ccacatgact gccctcctca aagacaaaga cagcttggca acctacatga ggacccttga
     1321 cctcgaggag gagaaagcca ggaagctttc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaattaac gctcttctgg cgagaatcgc cgctgcacgt tccctggtgc atcgggcgaa
     1441 agaggaactc tccagcagac caagacctgt tgttgttatg atatcaggta ggccagggat
     1501 agggaaaact caccttgcca gggagctagc caagaagatc gcagcttcac tcacagggga
     1561 ccagcgcgtg ggtctcatcc ctcgcaatgg cgttgaccac tgggatgcat ataagggaga
     1621 aagagtcgtc ctatgggacg attatggaat gagcaatccc atccacgacg ccctcaggtt
     1681 acaggaactt gctgacacct gcccccttac gctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaat ctagccaacc cagcaccatt
     1801 ggactatgtc aactttgaag catgctcgag gcgcattgac ttcctcgtgt acgcagaagc
     1861 ccctgaggtc gagaaagcaa agcgtgattt cccaggtcaa cctgacatgt ggaagaacgc
     1921 atttagctct gacttctcgc acataaaact ggcgctggct ccgcagggtg gtttcgacaa
     1981 gaacggaaac accccacacg ggaaaggcgt catgaaaacc ctcaccactg gttccctcat
     2041 cgcccgagca tcagggctac tccatgagag gttggatgag tacgagctgc agggcccaac
     2101 tcccaccacc tttaattttg accgcaacaa ggtgcttgcg ttcagacaac ttgctgccga
     2161 aaacaagtat ggactgttgg acacaatgag agttggaaaa cagctcaagg atgttaagac
     2221 catgtcagag ctcaaacagg cactcaagaa tgtcgcaatc aagagttgtc agatagtgta
     2281 tggtggctgc acctacaggc ttgagtctga tggcaagggt gatgtaaaag ttgacagagt
     2341 tcagaacgcc actgtacaga ccaacaatga gcttgccggc gcactacacc atcttaggtg
     2401 cgccagaatc agatattatg tcaagtgtgt tcaggaggcc ctgtattcca tcatccaaat
     2461 cgctggggct gcatttgtta ccacgcgcat tgtcaagcgc atgaacatac aagatctctg
     2521 gtccaagcca caggtggagg acacagagga aatcgctagc aaggatgggt gcccaaaacc
     2581 ccaggatgat gaagagtttg ttgtctcatc cgatgacatc aaaaccgagg gcaagaaagg
     2641 gaagaacaag tctggccgtg gcaagaagca cacagcattt tcaagtaaag gtctcagtga
     2701 tgaagagtac gatgagtaca aaagaattag agaagaaaga aatggcaaat actccataga
     2761 ggaatacctc caggacagag acaggtatta tgaggaggtg gccatcgcca gggcaaccga
     2821 agaggacttc tgtgaagaag aagaggccaa gatccgacag aggatcttca ggccaacaag
     2881 gaaacaacgc aaagaggaga gagcctctct cggtttggtc acaggttctg aaatcaggaa
     2941 gaggaaccca gacgacttca agcctaaagg aaagctgtgg gctgatgatg acaggagtgt
     3001 tgactacaat gaaagactca actttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggctca ggttggggct tttgggtttc ccccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacagg agttctttgg tgtacccatc aaacaaatcc agatacacaa
     3181 atcaggtgaa ttctgccgct tgaggtttcc aaagccgatc agaactgacg tgacaggcat
     3241 gatcttagaa gaaggtgcac ccgaaggaac cgtggtcaca ttactcatca aaagaccaac
     3301 tggagagctc atgcccctgg cagccagaat gggaacccac gcaaccatga agatacaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct cctaacagga tccaacgcca agagtatgga
     3421 cctgggcacc acaccaggtg actgtggctg cccctacatt tacaagaggg ggaatgacta
     3481 cgtggtcatt ggggtccata cagctgccgc ccgtggagga aacactgtca tttgtgccac
     3541 ccaggggagc gagggagaag ccacacttga aggcggtgat agcaagggga cctactgcgg
     3601 agcaccaatc ttaggtccag gaagtgcccc aaaactcagc accaagacca agttctggag
     3661 atcatccacg gcaccactcc cacctggtac ctatgaacca gcttacctcg gtggcaagga
     3721 ccccagagtt aagggtggcc cttcactgca acaagttatg agggatcaac tgaaaccatt
     3781 cactgagcct aggggtaggc caccaaaacc aagtgtgcta gaagctgcca agaaaaccat
     3841 cgtcaatgtc ctagaacaga caattgaccc acctcaaaaa tggtcgtttg cgcaggcatg
     3901 cgcatcccta gacaagacca cttctagcgg ccatccgcac cacatgcgga agaatgactg
     3961 ctggaacggg gagtccttca caggaaaatt ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaggag ggaaagaaca tgaccccagt ttacacgggt gcgcttaagg acgagctggt
     4081 caagactgac aagatttatg gtaagatcaa aaagaggctt ctctggggtt cggacctggc
     4141 gaccatgata cggtgcgctc gagcattcgg gggtctgatg gaggaactca aagcacattg
     4201 tgtcacacta cctgttaggg tgggtatgaa tatgaatgag gatggcccta tcatctttga
     4261 gagacactcc agatataaat atcattatga tgctgactac tcccggtggg attcaacaca
     4321 acaaagagcc gtgttggcag cagccttaga aatcatggtc aagttttccc cagagccaca
     4381 cctggcccaa aaggttgcag aagaccttct ttctcccagc gtgatggacg tgggtgattt
     4441 caaaatatca atcaatgagg gtctcccctc cggagtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ctctctgtgc actctctgag gttacaaacc tgtcccctga
     4561 cattattcag gctaactctc tcttttcttt ctacggtgat gatgaaattg tgagtacaga
     4621 cataaaattg gacccagaaa aactgacagc aaaactcaag gaatacgggt tgaaaccgac
     4681 ccgccctgac aaaactgaag ggcctcttgt catttccgaa gacctgaatg gcctaacctt
     4741 cctgcggagg accgtgactc gcgacccagc aggctggttt ggaaagttgg aacagagctc
     4801 aatactcaga caaatgtact ggactagggg ccccaaccat gaagatccat ctgaaacaat
     4861 gataccacac tcccagaggc ccatacaatt gatgtctttg ctgggtgagg cagcactcca
     4921 cggcccagca ttctacagca aaatcagtaa actggtcatt gcagagttga aggagggtgg
     4981 catggatttt tacgtgccaa gacaagagcc aatgttcaga tggatgagat tctcggatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccac cccatctaat gatggtgccg ccggcctcgt cccagagatc aacaatgagg
     5161 caatggcgct agatccagtg gcgggtgcag cgatagcagc acccctcacc ggccagcaaa
     5221 atataattga tccctggatt atgaataatt ttgtgcaagc acctggtggt gagttcacag
     5281 tgtctcctag gaattcccct ggtgaagtgc tcctcaattt ggaattgggc ccagagataa
     5341 acccctatct ggcccatctt gctagaatgt ataatggtta tgcaggtggg tttgaagtgc
     5401 aggtagtcct ggctggaaat gcgtttacag caggaaagat aatctttgca gctatacccc
     5461 ctaacttccc aattgacaat ctaagtgcag cacagatcac aatgtgccca catgtgattg
     5521 tggatgtcag gcagctggaa ccggtcaacc tcccgatgcc tgacgttcgc aataacttct
     5581 tccactacaa ccaagggtct gattcgagat tgcgcttggt tgcaatgctg tatacacctc
     5641 ttagggcaaa taactctggg gatgatgttt tcactgtgtc ttgtagagtg ctgactagac
     5701 ctagtcctga attttcattt aacttccttg tgccacccac tgtggagtca aagacaaaac
     5761 cttttaccct cccaattctg actatctctg aaatgtctaa ttctaggttt ccagtgccga
     5821 ttgattctct gcacaccagc ccaactgaga atattgttgt ccagtgccaa aatggacgcg
     5881 tcactcttga tggcgagttg atgggcacca ctcagctctt acctagtcaa atctgtgctt
     5941 tcaggggcgt gctcactaga tcaacaagca gggctagtga ccacgccgac acagcaaccc
     6001 ctagattgtt taattattat tggcacatac aattggataa tctaaatggg actccttatg
     6061 atcctgcaga agacatacca ggccccctag ggacaccaga tttccggggc aaagtctttg
     6121 gcgtggccag ccaaagaaac cccgacagta caactagggc acatgaagca aaggtggaca
     6181 caacagctgg tcgcttcacc ccaaaactag gctcattaga gatatccact gaatctggtg
     6241 actttgacca aaaccaacca acaagattca ccccagttgg cattggggtt gaccacgagt
     6301 cagacttcca gcaatggtcc ttacccgatt actctggcca gttcactcac aacatgaact
     6361 tagccccagc tgttgctccc aacttccctg gtgagcagct ccttttcttc cgctcacagt
     6421 taccatcttc tggtgggcga tccaatggga ttctagattg cctggtcccc caggaatggg
     6481 tccagcactt ctaccaagaa tcagcccccg cccaaaccca ggtggctttg gttagatatg
     6541 tcaaccctga cactggtaga gtgttgtttg aggccaagct gcacaaatta ggtttcatga
     6601 ctatagctaa gaatggtgac tctccaataa ctgtcccccc aaatggatac tttaggtttg
     6661 aatcttgggt gaacccattt tacacacttg cccccatggg aactgggaat gggcgtagaa
     6721 gagttcaata atggctggtg cttttatagc aggattagct ggtgatatac tcacaaatac
     6781 tgtagggtct ctagttaatg caggggctaa tgctattaat caaaaagttg attttgaaaa
     6841 taataaatac ttgcaaaatg cttccttcaa tcatgataag gaaatgttaa atgcacagat
     6901 tgaggcaaca aagagattac aggctgatat gattgctatc aaacaggggg ttctgaccgc
     6961 tggcggcttt tcccccactg atgcagctcg cggggcaatc aacgccccca tgacaaaagc
     7021 cctagattgg aatggaacaa ggtactgggc accaagtgcc acctctacaa cctcgatgtc
     7081 gggtggcttc acaaaccagg ctgtgcacag aaccacgcca aattttaaaa tgaaccaggc
     7141 ccccagatcc acacccagca gtgggtcttc agtaaggtca ctctcaaccc aagtcactag
     7201 tctgagctca cactcgtccg ggtcgtctcg acccagcggg tctacagttg ctagctcatt
     7261 accatcctct aacaggacta gggactgggt caatcagcaa aatttcaatt tggaaccaca
     7321 catgcctggg tcacttagga cggcttttgt cactccacca tctagtacag cctctagttt
     7381 aggcactgtc tcaaccgtgc ccaaaaatgt tttggactcc tggacatctg cgtttaacac
     7441 gcgcagacag ccgctattcg cacaccttcg tagaaggggg gagtcaaatg tttagtgaaa
     7501 aggttatctt aaatttgatt taaattggat ctgatttgga atcttttaaa aaaaaa
//