Typing tool

Complete norovirus genomes

MG572182  GII.1
 GII.P16

Length: 7,518 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6692
ORF3: 6692..7471
LOCUS       MG572182                7518 bp ss-RNA     linear   VRL 18-JAN-2018
DEFINITION  Norovirus GII isolate SDJN170450, complete genome.
ACCESSION   MG572182
VERSION     MG572182.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7518)
  AUTHORS   Ao,Y.
  TITLE     Complete genome sequence of a novel recombinant GII.P16-GII.1
            norovirus associated with an outbreak in Shandong province, China
            in 2017
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7518)
  AUTHORS   Ao,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-NOV-2017) Viral Diarrhea, Institute for Viral Disease
            Control and Prevention of China CDC, No. 100 Ying-Xin Street
            Xuan-Wu District, Beijing 100052, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7518
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="SDJN170450"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China: Jinan City, Shandong Province"
                     /collection_date="08-Mar-2017"
                     /collected_by="Yuanyun Ao"
                     /note="genotype: GII.P16-GII.1"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AUF81839.1"
                     /translation="MKMASNDATVAVVCNNNSDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTFDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEG
                     APKSEDDEFVISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVVPAGITEAFGVSIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPGVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHARKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETTIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     CDS             5085..6692
                     /note="ORF2; major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AUF81840.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRMNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPFLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAIPPHFPLENLSPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQPEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELSNSRFPAPIDELYTSPNEGVVVQPQNGRSTLDGELLGTT
                     QLVPSNICAMRGRINAQVPDDHHQWNLQVTNTNGTPFDPTEDVPAPLGTPDFLANIYG
                     VTSQRNPDNTCRAHDGVLATWSPKFTPKLGSVVLGAWEDRDFDLNQPTRFTPVGLYDT
                     EHFDQWVLPNYSGRLTLNMNLAPSVSPLFPGEQILFFRSHIPLKGGTSNGAIDCLLPQ
                     EWIQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6692..7471
                     /note="ORF3; minor structural protein; minor capsid
                     protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AUF81841.1"
                     /translation="MAGAFIAGLAGDIVTNGIGTLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQILATKQLQADMIALRQGVLTAGGFSPTDAARGAVGAPMTQVLDWNG
                     TRHWAPGATKTTSFSGGFTSSSHARTLDLPKKTTAAPTPMPVSRPSSFASTVPTRSTV
                     IGGSSNPPSSIRSSSSVSSQSTPSSSRVSEWVQNQNRALEPYMRGALQTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWTSVFNTHRQPLFAHLRRRGESQA"
     3'UTR           7472..7518
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gtttgcaaca acaacagcga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggct aggcccaaac agcctgcccc gagagacaaa ccacaaaagc ccccaagacc
      181 accaactccc gagttggtca agaggatacc ccctcctcca cctaatggcg aagaagaaga
      241 agaaccagtc attaggtatg aggttaagag tgggatctct ggcctgcccg agctcacaac
      301 agtcccccaa ccggacgtgg ccaacacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggag gccaaggaac cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactat ggcctgtacg tggagaaagg tttggtgttg ggtgtgcaca aaccacctgc
      481 agccataagc atggcgagag tggaactgac gccgctgtca ttgtactggc gtgtggtgta
      541 cactccccaa tacctcatct cccctgaaac tctcaggagg ctcaacggag aggcattccc
      601 ttacaccgcc tttgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctt agcaggagga tggtgcaaag aacaacgggc ttcttcagac cttaccaaga
      721 gtggaacaga aaacccctgc ctaccatgga tgactccaaa attaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattattcac cagacccata aaagacctca taggaaaaat
      841 taaaccatta aacatactga atatactggc aacgtgtgac tggacgtttg ccggaatagt
      901 ggagtctctg atattacttg ctgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac tcggggatta cgagctgcaa gggccagaag acctcgccgt
     1021 tgaactcgta cctgtggtaa tgggagggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacgctcagg gcttgtaaag atcttggtgc
     1141 ctatggctta gagatactca aattggtcat gaagtggttc ttcccaaaga aagaggaggc
     1201 caatgagcta gccatggtga gggccataga ggatgctgta ctagatcttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccagaag gttatccaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgctggctcg aatagcagcg gccaggtcat tagtccatag
     1441 ggccaaggaa gagctatcta gcaggataag accagtagtt gttatgatat ctggcaaacc
     1501 aggaataggc aaaactcatc tggccaggga ggtggcaaga aaggtggcat ccactctcac
     1561 aggggatcaa agagtcggac tcataccaag aaacggtgtg gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtgctgt gggacgacta tggcatgagt aaccccattc atgatgctct
     1681 tcgcatacaa gaattggctg atacgtgtcc ccttacctta aattgtgaca gaattgaaaa
     1741 taaaggaaaa gtttttgaca gtgaagtcat aataatcaca acaaaccttg ccaatccagc
     1801 cccacttgat tatgtcaact ttgaggcctg ttccaggaga attgatttcc tggtgtacgc
     1861 tgaggcacca gacgtggaaa aggcaaaacg ggactttcct ggtcagccag atatgtggaa
     1921 ggacgccttc aagccggact tttcacacat caagctacag cttgcacctc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa aggagtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgtgcatcag gcctactgca tgagaggatg gatgaatttg agctccaagg
     2101 tcctacaatc accaccttca atttcgaccg gaacagaatt acagcattca gacaattggc
     2161 tgcagaaaac aagtatggac tggtggatac catgaaagtt ggcaatcaat taaaaggagt
     2221 gaaaaccatg gaagaactca aacaagcaat caggaatgtg accatcaaga ggtgccggat
     2281 catctacggt ggctccacat ttgaccttga atctgatggc aagggcaaag ttttggtgga
     2341 aaaggtcaag aacacctctg tacagaccaa caacgagttg gccggggccc tgcaccatct
     2401 caaacatgcc cgaatcaggt actatgtcaa atgtgtgcaa gaagcagtct attctattat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga acatacaaga
     2521 actctggtcg aagccacaat tagatcaaaa tgaatcagag actaaggaag gggcccccaa
     2581 gtcagaagat gacgagttcg tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaataag actggccgtg gcaagaaaca cactgcattc tccagcaagg gcctgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggagtatctt caagacagag acaggtacta tgaggagctc gccattgcca aggccacgga
     2821 agaagacttc tgtgaagagg aagagatcaa aatccgtcag agaattttcc gtcccaccag
     2881 gaaacaaaga aaggaagaga gggccacatt agggctagta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acagaagtgt
     3001 tgactacaat gagaaactgg actttgaggc ccccccaagc atatggtcta ggattgtgag
     3061 ctttggttct ggctggggct tctgggtatc accaagcctg ttcataacat caactcatgt
     3121 agtccccgca ggcataacag aagcatttgg agtctccatc aaacaaattc agatccacaa
     3181 atcaggtgaa ttttgccgat tcagattccc aaaaccaatt agaccagatg tgacaggaat
     3241 gatcttggaa gaaggtgcgc ctgagggcac cgtggcaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat gggaacacac gcaaccatga aaatccaagg
     3361 ccgcatggtt ggcggacaga tgggtatgtt gctcactgga tcaaatgcta aaggaatgga
     3421 tttgggaaca actcctggtg actgtggttg tccttacatc tataaaaggg gcaatgacta
     3481 catagtcatt ggggtgcaca ctgcagcagc ccgtggtgga aacaccgtca tctgtgccac
     3541 acagggaagt gagggtgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 ggcacccatt ctaggccctg ggggtgcacc aaaattgagc accaaaacca aattttggag
     3661 gtcatcgaac acgccccttc caccagggac atatgagcct gcctacctcg gcggccgtga
     3721 tccgcgtgtt aagggtgggc cctccttgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc aggggcaaac ctccaagacc aggtgtattg gaagcggcca aacaaaccat
     3841 catcaatgtc ctcgaacaaa ccctggaccc tccacaaaaa tggacatacg cacaggcgtg
     3901 tgcctcactt gacaaaacca cctccagcgg gcaccctcat cacgcccgaa agaatgaatt
     3961 ctggaatggt gagaccttca ctggcaaatt ggcagaccaa gcatcaaaag caaacctaat
     4021 gtttgaggaa gggaaacaca tgacaccagt gtatacagca gcactcaagg acgagctagt
     4081 caagactgag aaaatctatg gaaagatcaa gaagaggctg ctctggggct ctgacttatc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aggcacactg
     4201 catatcactc ccagtccgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatacaagt accactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gtactggcag cagccttaga aatcatggtc aaattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggatctgct ggcccctagt gtagtagatg taggagactt
     4441 taaaatcaca ataaatgaag ggctcccctc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgtgc cctgtctgaa gtcaccaaac tgtcccctga
     4561 catcatacag gcaaattcca tgttttcatt ttacggtgat gacgagattg tcagcaccga
     4621 cataaaattg gaccctgaac agttaaccgc caaattgaag gagtacggcc tgaaaccaac
     4681 ccgcccagac aaaaccgagg gacccctgat catcagtgaa gatttgaacg gactcacttt
     4741 cctccgaagg acggtgactc gtgacccagc tggctggttt ggaaaactgg accaaagctc
     4801 aattttgagg cagatgtact ggactagagg accaaatcat gaagacccca atgagacaac
     4861 gataccccat tctcaaagac ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta aaatcagtaa attggtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc catgttcagg tggatgagat tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctaat gatggtgcag ccggtctcgt accagaggtc aacaacgaga
     5161 cgatggcact tgaaccggtg gctggggctt ccatagctgc ccccctgacc ggtcaaaaca
     5221 atgtgataga cccctggatt agaatgaact ttgtccaagc cccaaatggt gagtttacag
     5281 tgtccccccg caattcccca ggtgaagtat tgctaaattt ggaattaggt cctgaattga
     5341 atccattctt ggcgcacctt tcaaggatgt acaatggtta tgcagggggg gttgaagtgc
     5401 aggtgctgct cgctgggaat gcgtttacag cgggaaaatt ggtttttgca gcaatccctc
     5461 cacattttcc ccttgaaaac ttgagccctg gacaaattac tatgtttcct catgtgatta
     5521 ttgatgttag gacgttagaa cctgtcctct tacctctccc agatgttaga aacaacttct
     5581 tccattacaa tcagcaaccc gaaccccgaa tgaggcttgt tgctatgttg tatacccctc
     5641 ttagatctaa tggttctggt gatgatgtgt ttacagtttc ttgcagggtt ctcacccgcc
     5701 cttctcctga ctttgatttt aactatttgg tccccccaac agtggagtcc aaaacaaaac
     5761 cattcaccct accaattttg actattgggg aattgtcaaa ttctaggttc ccagctccaa
     5821 tagatgaact gtacaccagc cccaatgaag gagtggtggt gcaaccacaa aatggtagat
     5881 caacactcga tggtgaacta ctgggcacca cacaacttgt gccttcaaac atttgtgcga
     5941 tgcgaggacg catcaatgcc caagtgccag acgatcacca tcaatggaac ttgcaggtca
     6001 caaatacaaa tgggaccccc ttcgatccca ccgaagatgt ccctgcacca ttgggcacgc
     6061 cggacttcct ggcaaacatc tatggagtca ccagtcagag aaacccagac aacacctgtc
     6121 gtgcccacga cggggttttg gcaacttgga gccctaagtt cacacccaag ttaggatccg
     6181 ttgtcctagg tgcctgggaa gacagagact ttgatctcaa ccaacccaca aggttcacac
     6241 ccgttggatt gtatgataca gaacattttg accagtgggt cctgcccaat tactctggaa
     6301 gattgacctt gaacatgaac ttggcaccct ctgtatctcc cctctttcca ggtgaacaaa
     6361 ttctcttctt taggtcccat ataccactta agggaggcac ttctaatggt gccattgact
     6421 gcctgcttcc ccaggaatgg attcagcatt tctaccagga atcagccccg tcacccacgg
     6481 atgtggctct aattaggtat accaaccctg acacaggtcg agtcttgttt gaggccaaat
     6541 tgcacagaca ggggttcatt acagtggcaa attctggttc tagacctatt gttgttcctc
     6601 ctaatggtta ttttagattt gattcttggg ttaatcaatt ttattctctt gcccccatgg
     6661 gaactggtaa cgggcgtaga agggtacagt aatggctgga gcttttatag caggtcttgc
     6721 tggtgacata gtcaccaatg gcattgggac actggtaaat gctggggcaa atgcaataaa
     6781 tcaaaaggta gattttgaaa ataacaagca attacaacaa gcctctttca atcatgataa
     6841 ggaaatgttg caagcccaga ttttggcaac aaaacagtta caggctgata tgattgctct
     6901 cagacaaggg gtgttgaccg cgggcggctt ctctcctact gatgcagcaa ggggggcggt
     6961 tggtgcacct atgacgcaag tcttggactg gaatgggact aggcattggg cccctggagc
     7021 cacaaaaaca acatctttct ccggtgggtt cactagctct tcccatgcta gaactcttga
     7081 tttgccaaag aaaacaacag ctgcaccaac cccgatgcct gtatctagac ccagttcttt
     7141 tgcttctaca gttcctactc gctcaacagt cattggtggg tcttctaatc ccccttcctc
     7201 gatcaggagc tcttctagtg tttcttccca atctactccc tcttcttctc gggttagtga
     7261 atgggtgcaa aatcagaata gggcactgga gccgtacatg aggggagcgc tacaaacagc
     7321 ttacgtgacg cccccctcca gtagggcttc cagtaatggc acagtctcaa ccgtgccaaa
     7381 agaagttttg gactcctgga catctgtgtt taacacccac agacagccgc tcttcgctca
     7441 tctccgccgg agaggggagt cacaggctta gtgaaaagat aattttcttc ttttcttctt
     7501 tggaaaattt tatctttt
//