Typing tool

Complete norovirus genomes

MG548737  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       MG548737                7559 bp ss-RNA     linear   VRL 30-NOV-2018
DEFINITION  Norovirus GII isolate Hu/GII.4/Suncheon/2016, complete genome.
ACCESSION   MG548737
VERSION     MG548737.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Ju,S.
  TITLE     Complete Sequence Anlysis of the Norovirus GII.4 in South Korea
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Ju,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-NOV-2017) Food Safety Evaluation Department, National
            Institute of Food and Drug Safety Evaluation, Osong-Bio2, Cheongju,
            Chungcheongbuk-do KS001, South Korea
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC genomics v. version 10
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.4/Suncheon/2016"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="South Korea"
                     /collection_date="22-Apr-2016"
                     /note="genotype: GII.4"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AUF81807.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     FAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGVGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEAANEDGC
                     PKPKDNEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKDGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVMDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="ORF2; major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AUF81808.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGRVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRDVHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="ORF3; minor structural protein; minor capsid
                     protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AUF81809.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRINPRTPTPARGSPSTSS
                     NASTATSIYSNQTVSTRLGSTAGSGTNISSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acaaaatgtt ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaagatccc tcctcccccg cccaacggag aggatgaagt
      241 agtggtttct tatagtgcca aagacggcgt ttccggtttg cctgagcttt ccaccgtcag
      301 gcaaccggaa gaaaccaata cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 ggatgctaag gaaccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgttgagc gaggtcttgt gctgggtgtg cacaaaccac cagctgccat
      481 tagcttcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcagtacctc atctctcctg acactctcaa gaaattacac ggagaaacat ttccctacac
      601 agccttcgac aacaattgct atgccttttg ctgctgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcta acatattcct
      781 gtgcaccctg tcttcgctat tcaccaggcc cataaaagac ataataggga agttaaggcc
      841 tctcaacatc atcaacatcc tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg atttcgagtt acaaggacct gaggaccttg tagtggagct
     1021 cgtccctgta gtaatggggg gagttggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catctacctt gagagcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttag tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtactggac cttgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctatatga gaacccttga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc cgctgcacgc tccctggtgc accgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcatcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggttgtc ctatgggacg actatggaat gagcaatccc atccacgacg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaattgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat cactactaac ttggctaacc cagcaccact
     1801 ggactatgtc aactttgaag cgtgctcgag gcgcatcgat ttcctcgtgt atgcagaagc
     1861 ccccgaggtc gaaaaggcga agcgtgactt cccgggccaa cctgacatgt ggaaaaacgc
     1921 ttttagtcct gatttctcac acataaaatt ggcactggct ccacaaggtg gctttgacaa
     1981 gaacggaaac accccacacg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggca tcagggctgc tccatgagag attggatgag tttgaactac agggcccagc
     2101 tcttaccacc ttcaactttg accgcaacaa agtgcttgcc ttcagacagc ttgctgctga
     2161 aaacaaatac gggttgatgg acacaatgaa agttgggagg cagctcaagg atgtcaaaac
     2221 catgccagaa cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agattgtgta
     2281 tagtggttgc acctacacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcacc tccgttcaga ccaacaatga gctggctggc gccctgcacc atctaaggtg
     2401 cgccagaatc aggtactatg tcaagtgtgt tcaggaggcc ctgtattcta tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat catcaagcgt gtgaacattc aagacttatg
     2521 gtccaagcca caagtggaaa acacagagga ggctgccaac gaggacgggt gcccaaagcc
     2581 caaagataat gaggagttcg tcatttcatc tgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agagaattag agaggagagg aatggcaagt attccataga
     2761 ggagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca gaccaacaag
     2881 gaaacaacgc aaggaagaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aaggaaccca gaagacttca agcctaaggg gaaactatgg gctgacgatg acagaagtgt
     3001 ggactacaat gaaaaactca gctttgaggc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggctca ggttggggct tctgggtctc ccccagcctg ttcataacat caacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacacaa
     3181 gtcaggcgaa ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgactggcat
     3241 gatcttggaa gaaggtgcgc ccgagggcac cgtggtcaca ctactcatca aaaggtctac
     3301 tggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga aaattcaagg
     3361 acgcactgtt ggaggtcaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 cctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggggtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggggt gagggggaag ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggggtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctaccttg gtggcaagga
     3721 ccccagagtc aaggatggcc cctctttgca gcaagtcatg agggaccagc tgaaaccatt
     3781 tacagagcct aggggtaagc caccaaagcc aagcgtgttg gaagctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgaccc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttctagcgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacaggt gcacttaagg atgagttagt
     4081 taaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggatttggc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggtctaatg gatgaactca aagcacactg
     4201 tgtcacactt cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacagat accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtgctggcag ctgctctaga aatcatggtt aaattctcct cagaaccaca
     4381 cttggctcag gtagtagcag aagaccttct ttctcctagc gtgatggatg tgggtgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc actctccgaa gttacaaatt tgtccccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagtacaga
     4621 cataaaatta gacccagaga agttgacagc aaagcttaag gaatacgggt tgaaaccaac
     4681 ccgccctgat aaaactgaag gacctcttgt tatttctgaa gacttggatg gtttgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagctc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat gaagacccat ctgaatcaat
     4861 gattccacac tctcaaagac ccatacaatt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccaaca ttctacagta aaatcagcaa attagtcatt gcagagctaa aagaaggtgg
     4981 tatggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggctct ggagcccgtt gtcggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatctga
     5341 atccctacct atctcatttg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ccggaaaaat tatatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagtccca gccaggttac tatgttcccc cacataatag
     5521 tggatgttag gcaattggaa cctgtattga tccccttacc tgatgttagg aataacttct
     5581 accactataa tcagtcaaat gattctacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggccaa taatgctggg gaagatgtct tcacagtctc ttgtcgagtt ctcacgaggc
     5701 catcccctga ttttgatttt atatttttgg tgccacctac agttgagtca agaactaaac
     5761 catttactgt cccaatctta actgttgaag aaatgaccaa ttcaaggttc cccattcctt
     5821 tggaaaaatt gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggcacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggtt ctcgtaatta cacaatgaat ttggcttctc
     6001 taaattggaa caattatgac ccaacagaag aaattccagc ccctctagga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcactc aaaccacaaa gggagatggc tcgacccgtg
     6121 gccataaagc tacagtttac actgggagtg ccccctttac tccaaagctg ggcagagttc
     6181 agttcagtac tgacacagaa aatgattttg aaactcacca aaacacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggt ggcaccaccc accgaaatga accccaacaa tgggtactcc
     6301 caagttattc aggtagagat gtccataatg tacacctagc ccctgctgta gcccccactt
     6361 ttccgggtga acaacttctt ttcttcaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatggattt ggattgcctg ctcccccagg agtgggtgca gcacttctac caagaggcag
     6481 ctccagcaca atctgatgtg gctctattga gatttgtgaa tccagacacg ggtagggtcc
     6541 tgtttgagtg caaactccat aaatcaggct atgtcacagt ggctcacacc ggccagcatg
     6601 atttggtcat cccccccaat ggttatttta ggtttgattc ctgggttaat caattctata
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc tttataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttag ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggct atcaaccaaa agattgattt tgaaaataat agaaaattgc agcaagcttc
     6841 cttccagttt agcagtaatc tacaacaggc ttcctttcaa cacgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acaggaaatg atgaaagtca aacaggcaat
     6961 gctcttagaa ggtggattct ctgaaacaga tgcagcccgt ggggcaatca acgcccctat
     7021 gacaaaggct ttggattgga gcggaacaag gtactgggcc cctgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ccacccctca accttcgggg gcactgccag gaagaatcaa
     7141 tcctaggact cctacccccg ctcggggctc ccccagcaca tcttctaatg cttctactgc
     7201 cacttctata tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccaatatc tcgagtctcc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagaaatttg tcacctttca tgaggggggc tcacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt cctttcttta gtgtctttt
//