Typing tool

Complete norovirus genomes

MG049693  GI.4
 GI.P4

Length: 7,602 | 3 CDS

ORF1: 1..5358
ORF2: 5342..6976
ORF3: 6976..7602
LOCUS       MG049693                7602 bp ss-RNA     linear   VRL 28-OCT-2017
DEFINITION  Norovirus GI isolate CYY1, complete genome.
ACCESSION   MG049693
VERSION     MG049693.1
KEYWORDS    .
SOURCE      Norovirus GI
  ORGANISM  Norovirus GI
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7602)
  AUTHORS   Yen,J.-B., Wei,L.-H., Chen,L.-Y., Chen,L.-W., Hung,C.-H.,
            Wang,S.-S. and Chang,P.-J.
  TITLE     Subcellular localization and functional characterization of GII.4
            norovirus-encoded NTPase
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7602)
  AUTHORS   Yen,J.-B., Wei,L.-H., Chen,L.-Y., Chen,L.-W., Hung,C.-H.,
            Wang,S.-S. and Chang,P.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-2017) Graduate Institute of Clinical Medical
            Sciences, Chang-Gung University, 6 West, Chia-Pu Road, Puzi,
            Chiayi, Taiwan 613, Taiwan
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7602
                     /organism="Norovirus GI"
                     /mol_type="genomic RNA"
                     /isolate="CYY1"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122928"
                     /country="Taiwan"
                     /collection_date="12-Jan-2009"
                     /collected_by="Chang-Gung Memorial Hospital at Chiayi"
     CDS             1..5358
                     /note="ORF1; contains Nterm, NTPase, P22, VPg, Protease,
                     and RNA polymerase"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ATN44701.1"
                     /translation="MMMASKDVVAATAASAENTSDNSESIKNRFFTRLKNLGSNNKPI
                     KIENTHMALDLISRGPSPAPQERPPKDQRDKPPRNVTETQQAMGWIDPPVDQNLPTWE
                     ELSQTEKQEILKNNSNWFDAGGLAPASIPSGYVKNTEQQPPDHQVKWSVNNGVDLGVD
                     SLTTVPGPTWNLCPMPPIDQRNNGPAKEPLIGDMIEFYEGHIYHYAIYIGQGKTVGVH
                     SPQAAFSIARITIHPIAAWWRVCYVPTPDQRLNYDQLKELENEPWPYAAVTNNCYEFC
                     CRILNLQDTWLERRLVTSSRFNHPAQDWSRDTPDFQQDSKLEIVRDAVLAAINGLVPK
                     PFKDLLNKLKPLNVLNLLSNCDWTFMGVVETIILLMELFGIFWNPPDVSSFIASLLPD
                     MHLQGPEDLAKDLIPLVLGGVGLAIGFTKDKVTKVMKSAVEGLRAATQLGQYGLEIFA
                     VLKKYFFGGDQTEKTLKDIETAVIDMEVISTTAVTQLVRDKQAARTYMNILDAEEEKA
                     RKLSVRHADPHVVSTTNALISRTSLARPALAKAQAEMTNRVKPVVIMMCGPPGIGKTK
                     AAEYLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMSKIADDCNKLQA
                     IADTAPLTLNCDRIEKKGLQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVYCTA
                     PDVEQTRRTNPGDTGALKDCFKSDLSHLKMELAPQGGFDNQGNTPFGKGTMRPTTLNR
                     LLIQAVALTMERQDEFQMQGQVYDFDADRVSAFTSLARANGLGLISMASLGKKLRGVD
                     SVHGLKNALSGYTITPCSIKWQARVYDIESDGTNVHIKENTSAQTQRQQSIDTAALAL
                     TRLKAARAAAYAACIQSAITTILQMAGSAIVINRAVKRMFGAHPSTIALEGPPREHRC
                     RAHLAKAAGGGPIGHDDVIDKYGLCETEEEGTSEEMNVELPTATSEGKNKGKTKKGRG
                     RRANYNAFSRRGLSDEEYEEYKKIREEKNGNYSIQEYLEDRQRYEEELAEVQAGGDGG
                     IGETEMEIRHKIFYKSKKGRQSERRQLGLVTGSDIRKRKPIDWTPPKNDWADDNREVD
                     YNEKLSFEAPPTLWSRVVRFGSGWGFWVSPTVFITTTHVIPSGVREFFGEPIESIAIH
                     RAGEFTQFRFSRKVRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIASMK
                     IQGRLVHGQSGMLLTGANAKGMDLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNT
                     VVCAVQAGEGETTLEGGDKGHYAGHEIIKHSKGPALSTKTKFWRSTPEPLPPGVYEPA
                     YLGGRDPRVKGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSMLEQTMDTPT
                     PWSFSDACQSLDKTTSSGHPYHKRKNDDWNGTSFVGELGEQAAHANNMYELGKSMKPL
                     YTAALKDELVKPEKVYQRIKKRLLWGADLSTVIRAARAFGPFCDAIKPHVIKLPIKVG
                     MNSIEDGPMIYAEHAKYKNHFDADYSAWDSTQNRQIMTESFAIMCRLTASPELASVVA
                     KDLLAPSEMDVGDYIIRVKEGLPSGFPCTSQVNSINHWLITLCAMSEVTGLSPDVIQS
                     QSYFSFYGDDEIVSTDIDFDPARLTQVLKEYGLRPTRPDKSEGPIILRRQVDGLVFLR
                     RTISKGAAGFQGRLDRGSIERQLWWTRGPNHDDPSETLIPHPQRKVQLISLLGEASLH
                     GEKFYRKISSKVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVNDDG
                     V"
     CDS             5342..6976
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ATN44702.1"
                     /translation="MMMASKDATPSADGATGAGQLVPEVNTADPIPIDPVAGSSTALA
                     TAGQVNLIDPWIINNFVQAPQGEFTISPNNTPGDVLFDLQLGPHLNPFLSHLSQMYNG
                     WVGNMRVRVVLAGNAFTAGKVIICCVPPGFQSRTLSIAQATLFPHVIADVRTLDPVEV
                     PLEDVRNVLYHNNDTQPTMRLLCMLYTPLRTGGASGGTDSFVVAGRVLTCPGPDFNFL
                     FLVPPTVEQKTRPFTVPNIPLKYLSNSRIPNPIEGMSLSPDQTQNVQFQNGRCTIDGQ
                     PLGTTPVSVSQLCKFRGRITSGQKVLNLTELDGSPFMAFAAPAPAGFPDLGSCDWHIE
                     MSKIPNSSTQSNPIVVNSVKPNSQQFVPHLSSITLDDNVSSGGDYIGTIQWTSPPSDS
                     GGANTNFWKIPDYGSSLAEASQLAPAVYPPGFNEVIVYFMASIPGPNQSGSPNLVPCL
                     LPQEYITHFISEHAPIQGEAALLHYVDPDTNRNLGEFKLYPGGYLTCVPNSSSTGPQQ
                     LPLDGVFVFASWVSRFYQLKPVGTAGPARGRLGVRR"
     CDS             6976..7602
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="ATN44703.1"
                     /translation="MAQAIIGAIAASAAGSALGAGIQAGAEAALQAQRYQQDLTLQQN
                     SFNHDKEMLGYQMEMSNKLLAKNLNTRYSLLQAGGLSSSDAARAVAGAPVTRLVDWGG
                     VRVAAPQSSATTLRSGNFMAVPLPAQPKQKPLASEGYSNPAYDPVQRTASWVQSQNSS
                     RSWSPYHRQALQTVWVTPPGSTSSSSVSTAPRGYFNTDRLPLFANLRR"
ORIGIN      
        1 atgatgatgg cgtcgaaaga cgtcgttgca gctactgctg ctagtgctga aaacactagt
       61 gacaatagtg aatctataaa gaaccgcttc ttcacaagat tgaagaattt aggttctaac
      121 aataaaccta taaaaattga aaacacccat atggccctcg acttgattag tagagggcca
      181 tctccagccc cacaagaaag gccccccaaa gatcagaggg acaaaccccc aaggaatgtg
      241 actgaaactc aacaggcaat ggggtggatt gacccccccg tggatcagaa cctaccaacc
      301 tgggaggaat tgagccaaac agaaaaacaa gagatactca agaacaattc aaactggttt
      361 gatgctggtg gactggcacc agctagtatc ccttccggtt atgtgaaaaa cacagagcaa
      421 caaccccctg accaccaggt caaatggagt gtaaacaacg gggttgatct gggggtggac
      481 agtttaacta ctgtgccagg cccaacatgg aacctgtgcc ccatgccacc aattgaccaa
      541 cggaacaatg gcccggcaaa agagccactt attggtgata tgatagaatt ctatgaggga
      601 cacatttacc attatgcaat atatattggc caaggaaaaa ctgttggggt ccactcacct
      661 caagcggcct tttcaatagc cagaataact atacacccca ttgctgcttg gtggagggtt
      721 tgttatgtgc caacgcctga tcagagatta aattatgacc aactcaaaga gcttgagaat
      781 gagccatggc catatgctgc agtcaccaat aattgctatg agttctgctg cagaatcctc
      841 aacctgcagg atacttggtt ggagcgccgc ctagttacgt ccagtcgttt taaccatcca
      901 gcacaagact ggtctaggga cacgcctgac ttccaacaag atagcaaact agaaatagtc
      961 agggatgctg tgcttgctgc aattaatggc ttggtgccaa aaccctttaa agacctccta
     1021 aataaactta agccactcaa cgtgcttaac ctactctcca actgcgattg gacatttatg
     1081 ggagtagtgg agacaataat attacttatg gaactgtttg ggattttctg gaacccccct
     1141 gatgtgtcca gtttcatagc ctcactacta cccgatatgc atctgcaagg accagaagat
     1201 ctggctaaag atttgatacc actggtgttg gggggtgtag gacttgcaat tgggtttacc
     1261 aaggacaagg ttacaaaggt catgaagagc gctgttgaag gacttagggc agccacacaa
     1321 ttgggtcagt atggcttaga gatatttgca gtcttaaaga aatacttctt tggcggagac
     1381 caaacagaga agactttaaa ggacattgag acagccgtaa ttgacatgga ggtcatttca
     1441 acaactgctg tcactcaatt agtcagggac aagcaggctg cccgaaccta catgaacatc
     1501 ttggatgccg aagaagaaaa ggcaagaaag ctttcagtca ggcatgcaga cccccatgtc
     1561 gtgtccacga ctaatgcctt gatctcacgc acttctttgg ctcgccctgc acttgctaag
     1621 gcacaagctg agatgactaa cagagttaaa ccagtagtaa taatgatgtg tggccctcca
     1681 ggcataggca agacaaaggc agctgagtac cttgctaaga gattggctaa tgagatacgg
     1741 cctggaggaa aagtgggtct cgtgccaaga gaggctgtgg atcactggga tggatatcac
     1801 ggtgaagagg ttatgctatg ggatgattat ggtatgtcaa aaatagctga tgattgtaat
     1861 aagttgcagg ccatagccga cacagctcca ctcaccttga attgtgaccg gattgagaag
     1921 aaagggttac agttcgtctc tgatgccata gtgataacaa caaatgcccc aggcccagcc
     1981 cctgttgact ttgtcaatct tggcccagtg tgccgacggg tagacttcct ggtttattgc
     2041 actgcacctg acgttgaaca aacacgtcgc accaaccctg gagacactgg agcccttaag
     2101 gattgcttca aaagtgacct ctcccatcta aaaatggagt tggccccaca gggcggattt
     2161 gataatcaag ggaacactcc atttggcaaa gggaccatgc ggcccaccac gttaaaccgt
     2221 cttctcatac aagctgtggc gctaaccatg gagcgtcagg atgaattcca gatgcaaggt
     2281 caagtgtatg attttgatgc tgacagggta tccgctttca ccagtttagc gagagccaat
     2341 ggtctgggcc tcattagtat ggcctctcta ggaaagaaat tgaggggtgt ggactcagtc
     2401 catggcctca agaatgcatt atcaggctac accataaccc cttgtagtat aaaatggcaa
     2461 gccagagtgt atgacattga atcggatggc actaatgtac acataaagga aaacacctca
     2521 gcccagacac aacgccagca gtcaattgac acagcagctc tagcactcac tagactcaag
     2581 gcagcacggg cagcagcgta tgcagcttgc atacaaagcg caataacaac tatcctacag
     2641 atggctgggt cagccatcgt tataaatcgt gctgtcaaaa ggatgtttgg ggcacaccca
     2701 agcaccatag cccttgaagg gccaccaagg gaacaccggt gtagagctca cctggccaaa
     2761 gctgcaggtg gtggaccaat aggccatgat gatgtcattg ataagtatgg tctatgtgag
     2821 actgaagaag agggcaccag tgaggagatg aatgtggagc ttcccaccgc cacttctgag
     2881 ggtaaaaata aaggtaaaac caagaaagga agaggcagaa gagccaacta caatgctttt
     2941 tcaaggcgag gtctgagtga tgaagaatac gaggagtata agaagatcag ggaagaaaag
     3001 aatggtaact acagtattca ggagtacctt gaagacagac aacgctatga agaagaactc
     3061 gcagaagtgc aagctggtgg tgatggaggc attggtgaga cagaaatgga gatccgacac
     3121 aagatcttct ataaatccaa aaagggccgc caaagtgaac gccgccagtt aggattagtc
     3181 actggtagtg acattagaaa gagaaaacca attgattgga ccccccccaa gaatgattgg
     3241 gcagatgata atagggaagt ggattacaat gaaaaactca gttttgaagc cccaccaacc
     3301 ctctggagcc gagttgtgag atttggctct gggtggggct tttgggtgag cccgactgtt
     3361 tttatcacca ccacccacgt tataccatct ggagtgcgtg aattctttgg agaacccatc
     3421 gaatccattg caatccaccg tgctggtgaa tttacacaat tcaggttttc acgtaaagtc
     3481 cgcccggatt tgactggaat ggtcttggag gaaggctgcc ctgagggtgt cgtgtgttcc
     3541 atcctcatta aacgcgactc tggtgagctg ctaccccttg ctgttcgaat gggcgctata
     3601 gcgtccatga agatccaggg gaggttagtg catggtcaat ctgggatgct gcttactggg
     3661 gccaacgcta aagggatgga cttaggtacc ctaccaggtg attgtggtgc cccttatgtg
     3721 tacaagagga acaacgactg ggtggtttgt ggtgtacatg cagctgccac gaaatcaggc
     3781 aacactgtag tgtgtgctgt ccaggctggg gagggtgaaa ccaccttaga gggaggtgat
     3841 aaaggtcact atgctggtca tgagataatc aagcacagta agggcccagc tttatcaacc
     3901 aagaccaagt tctggaggtc aacccctgaa ccactgccgc caggtgttta tgaaccagca
     3961 taccttgggg gccgtgaccc aagggtaaaa ggtggacctt ccctacaaca agtcctgcgt
     4021 gaccagctga aaccgtttgc tgagccacga ggtcgaatgc cagaacctgg tctacttgag
     4081 gcagccgttg aaactgtcac atccatgctt gaacaaacaa tggatacacc aaccccttgg
     4141 tctttctctg atgcatgtca gtcacttgac aaaaccacaa gttcggggca cccataccat
     4201 aaaaggaaaa atgatgattg gaatggaact tcatttgttg gggagcttgg agaacaggcg
     4261 gcacatgcca acaacatgta tgagttaggc aagtccatga aaccacttta cactgcagcc
     4321 ctaaaagatg agttagtcaa gcctgagaaa gtctatcaga ggattaagaa aaggctcctc
     4381 tggggtgctg atctctcaac agttataaga gctgccagag cctttggacc attttgtgat
     4441 gccataaagc ctcatgtcat taaactccct atcaaagttg gtatgaactc catagaagat
     4501 ggcccaatga tttacgcaga acatgcaaag tataagaatc attttgatgc agattattcg
     4561 gcctgggatt ctacacaaaa tagacagatc atgactgagt cctttgcaat catgtgccgc
     4621 ctcacggcat caccagaatt ggcctctgtt gtagccaaag atctacttgc gccttcagag
     4681 atggatgttg gggactacat catccgtgta aaagaaggtt tgccatcagg atttccttgc
     4741 acttcacagg tgaacagtat aaaccattgg ctaatcacac tgtgtgctat gtctgaagtc
     4801 acaggcttat cacccgatgt catacaatcc cagtcttact tttctttcta tggtgatgat
     4861 gaaatagtct caacagatat tgattttgac cccgcccgcc tcactcaggt gcttaaagaa
     4921 tatgggttga gacccacccg accagacaag tcagaaggac ccatcatact tagaagacag
     4981 gtggatggcc ttgttttctt aaggaggaca atctcaaaag gtgctgcggg cttccagggg
     5041 aggctagaca ggggctcaat tgaaaggcag ctctggtgga ctcgaggtcc taaccatgat
     5101 gaccccagtg agactctaat cccacacccc cagaggaaag ttcagcttat atccctcctt
     5161 ggtgaggctt ccctccatgg tgagaaattt tacaggaaaa tctccagtaa agttatacag
     5221 gagataaaga ctggtggttt ggaaatgtat gtaccaggct ggcaggccat gttccgctgg
     5281 atgcgcttcc atgacctcgg attgtggaca ggagatcgca atctcctgcc cgaattcgta
     5341 aatgatgatg gcgtctaagg acgctacacc aagcgcagat ggcgccactg gcgccggcca
     5401 gctggtaccg gaggttaata cagctgaccc tatacccatt gaccctgtgg ctggctcctc
     5461 tacagcactt gccactgcag gccaagttaa tttgattgat ccctggataa tcaataattt
     5521 tgtgcaagcc ccccagggtg aattcacaat atccccaaac aatacccccg gtgatgtgct
     5581 ttttgatttg cagttaggac ctcatttaaa ccctttcctc tcccatctct ctcagatgta
     5641 taatggctgg gtgggcaaca tgcgagtgcg tgttgtcttg gctggtaatg ctttcacggc
     5701 tgggaaggtt ataatttgtt gtgttccccc tggttttcaa tctcgtactc tttccatagc
     5761 tcaggctact ttattccccc acgtcattgc tgatgttagg acccttgacc ctgtagaagt
     5821 gcctcttgaa gatgtcagga acgtgttgta tcataataat gacacccaac ctaccatgcg
     5881 cctcctttgc atgttgtaca ctcctctccg caccggggga gcgtctggtg ggactgattc
     5941 cttcgtggta gctgggcgtg tacttacttg cccaggccct gactttaact tcttattctt
     6001 ggtccctcct acagtcgagc aaaagactcg ccctttcact gtacccaata tccctttgaa
     6061 gtatctgtct aactccagaa tcccaaaccc cattgaaggt atgtcattgt cacctgacca
     6121 gactcaaaat gtccaatttc aaaatggcag gtgcacaatc gatggtcaac ccctcgggac
     6181 tacacctgtc tcggttagcc agttatgtaa gtttaggggt aggattacat ctggacagaa
     6241 ggtgctcaat ttgacagagt tggatggttc accttttatg gcctttgctg cccctgcccc
     6301 tgcgggcttc ccagatcttg ggtcctgtga ttggcatatt gagatgagta aaatcccaaa
     6361 ttctagcacc cagagtaatc caatagtggt caattctgtc aagcccaata gtcaacagtt
     6421 tgtccctcac ttgtcaagca tcacccttga tgacaatgtt tctagtgggg gtgattatat
     6481 cggtactata caatggacct ctcctccttc tgattctggc ggagccaata caaacttttg
     6541 gaaaatccct gactatgggt ctagcttggc tgaagcttca cagctggccc ccgctgtcta
     6601 tccacctggt ttcaatgaag tgattgtgta ttttatggca tctatacctg gccccaatca
     6661 atctgggtcc cctaacttgg tgccatgcct actcccccag gaatatataa cacatttcat
     6721 tagtgagcac gcccccattc agggtgaggc tgccttactc cattatgtgg acccagacac
     6781 caatcgtaat ttgggtgagt ttaaattgta tcctggtggt tatttaacct gtgttcctaa
     6841 tagttctagt actggacctc aacagcttcc tcttgatggt gtttttgtct ttgcttcttg
     6901 ggtctctaga ttttatcaat taaagcctgt gggaacagcc ggaccggcta gaggtaggct
     6961 tggtgtccgt agataatggc ccaagccatt ataggagcca ttgccgcctc cgcagccggt
     7021 agcgcccttg gtgctggcat ccaggctggt gctgaagctg cgttgcaggc acagagatat
     7081 caacaagatc tgactttgca gcaaaattct tttaatcatg ataaggaaat gttaggttat
     7141 caaatggaaa tgtccaacaa gttgctagct aaaaatctta acacccgcta ttctcttctc
     7201 caggcgggtg gcctctcatc ctctgatgcg gctagggctg tagccggggc ccccgtcact
     7261 aggttggtcg actggggggg agtgcgtgtt gcggcacccc aatcatctgc caccacattg
     7321 agatctggta attttatggc tgtgccactc ccagctcagc caaaacagaa gccccttgcc
     7381 agtgaaggtt attctaaccc tgcttatgac cctgtgcaac gcacagcctc ttgggttcaa
     7441 tctcagaact ccagccggtc ttggtctcca taccataggc aagcccttca gactgtgtgg
     7501 gtgacccccc ctggttctac ctcttcttct tctgtttcta ctgcccctcg agggtatttc
     7561 aatacagata gattgcctct attcgcaaac ttgaggcgtt aa
//