Typing tool

Complete norovirus genomes

MG049692  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       MG049692                7509 bp ss-RNA     linear   VRL 28-OCT-2017
DEFINITION  Norovirus GII isolate YJB1, complete genome.
ACCESSION   MG049692
VERSION     MG049692.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7509)
  AUTHORS   Yen,J.-B., Wei,L.-H., Chen,L.-Y., Chen,L.-W., Hung,C.-H.,
            Wang,S.-S. and Chang,P.-J.
  TITLE     Subcellular localization and functional characterization of GII.4
            norovirus-encoded NTPase
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Yen,J.-B., Wei,L.-H., Chen,L.-Y., Chen,L.-W., Hung,C.-H.,
            Wang,S.-S. and Chang,P.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-2017) Graduate Institute of Clinical Medical
            Sciences, Chang-Gung University, 6 West, Chia-Pu Road, Puzi,
            Chiayi, Taiwan 613, Taiwan
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="YJB1"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Taiwan"
                     /collection_date="03-Feb-2009"
                     /collected_by="Chang-Gung Memorial Hospital at Chiayi"
                     /note="genotype: GII.4"
     CDS             1..5100
                     /note="ORF1; contains Nterm, NTPase, P22, VPg, Protease,
                     and RNA polymerase"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ATN44698.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYNAKDGISGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTTDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKVGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVQDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPVMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLIDTMKVGRQLKDVTTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELVGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGIHMAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTVPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGENMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRFRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ATN44699.1"
                     /translation="MKMASNDASPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPSGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLAALNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKADGSTRGHKATVYTGSADFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNVHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="ATN44700.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMIQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSSPQPSGALPGRINPRAPTPARGSSNTSS
                     NASTATSIYSNQTASTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHDI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaaacagcc ccccccgagg gaaataccac aaagaccccc acgaccaccc
      181 actccagaac tggtcaagaa gatccctcct cccccgccca acggagagga tgaagtagtg
      241 gtttcttata atgccaaaga tggcatttcc ggtttacctg agctctccac cgtcagacaa
      301 ccagaagaaa ccaatacggc cttcagtgtc cctccactca atcagaggga gaatagggat
      361 gctaaggaac cactgactgg aacaattctg gaaatgtggg atggagaaat ctaccattat
      421 ggcctgtatg ttgagcgagg tcttgtgctg ggcgtgcaca aaccaccggc tgccattagc
      481 ctcgccaagg tcgaactaac accactctcc ttgttctgga gacctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttgcacggag aaacatttcc ctacacagcc
      601 tttgacaaca attgctatgc cttttgttgc tgggtcctgg acctaaacga ctcgtggctg
      661 agtaggagaa tgatccagag aacaactggc ttcttcagac cctaccaaga ttggaatagg
      721 aaacccctcc ctactacgga tgattccaaa ttaaagaagg tagctaacat attcctgtgt
      781 accctgtctt cgctattcac caggcccata aaagacataa taggaaagtt aaggcctctc
      841 aacatcatca acatcctagc ttcatgtgat tggactttcg cgggcatagt ggagtccttg
      901 atactcttgg cagagctctt tggagtcttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttac tcggtgattt cgagttacaa ggacctgagg accttgtagt ggagctcgtc
     1021 cctgtagtaa tgggggggat tggtttggtg ctaggattca ccaaagagaa ggttggaaaa
     1081 atgttgtcat ctgctgcatc caccttgaga gcttgcaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttggtcat gaagtggttc ttcccgaaga aagaggaggc aaatgaactg
     1201 gctatggtga gatctatcga ggatgcagta caggaccttg aggcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga taaagacagc ctggcaacct acatgagaac ccttgacctc
     1321 gaggaagaga aagccaggaa actctcaacc aagtccgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgccgct gcacgctccc tggtgcaccg agcgaaggag
     1441 gagctttcca gcagaccaag acctgtagtc ttgatgatat caggcagacc agggataggg
     1501 aagacccacc ttgctaggga agtggctaag agaattgcag cctccctcac aggagaccag
     1561 cgtgtaggcc tcatcccacg caatggcgtc gatcactggg atgcgtacaa aggggagagg
     1621 gtcgtcctat gggacgacta tggtatgagc aaccccatcc acgacgccct caggctgcaa
     1681 gaactcgctg acacttgccc cctcacccta aattgtgaca ggatcgagaa taaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcact actaatctgg ccaacccagc accactggac
     1801 tatgtcaact ttgaagcgtg ctcgaggcgc atcgatttcc tcgtgtatgc ggaagccccc
     1861 gaggtcgaaa aggcgaagcg tgacttcccg ggccaacctg tcatgtggaa aaacgctttt
     1921 agttctgatt tctcacacat aaaattggca ctggctccac aaggtggctt tgacaagaac
     1981 gggaacaccc cacacggaaa gggcgtcatg aagactctca ccactggctc cctcattgcc
     2041 cgggcatcag ggctgctcca tgagagattg gatgagtttg aactacaggg cccagctctt
     2101 accaccttca actttgatcg caacaaagtg cttgccttca ggcagcttgc tgctgaaaac
     2161 aaatatgggt tgatagatac aatgaaagtt gggaggcagc tcaaggatgt cacaaccatg
     2221 ccagaactta aacaagcact caagaatatc tcaatcaaga agtgccagat tgtgtacagt
     2281 ggttgcactt acacacttga gtctgatggc aagggcaatg tgaaagttga cagagttcag
     2341 agtacctccg tacagaccaa caatgagctg gttggcgccc tgcaccatct aaggtgcgcc
     2401 agaatcaggt actatgttaa gtgtgtccag gaggccctgt attctatcat ccagattgct
     2461 ggggctgcat ttgtcaccac acgcatcatc aagcgtgtga acattcaaga cctgtggtcc
     2521 aagccacaag tggaaaacac agaggaggct accaacaagg acgggtgccc aaaacccaaa
     2581 gatgatgagg agttcgtcat ttcatctgac gacattaaaa ctgagggtaa gaaagggaag
     2641 aacaagactg gccgtggcaa gaagcacaca gccttctcaa gtaaaggtct cagtgatgaa
     2701 gagtatgatg agtacaagag gattagagag gaaaggaatg gcaagtactc catagaagag
     2761 taccttcagg acagggacaa atactatgag gaggtggcca ttgctagggc gaccgaggaa
     2821 gacttctgcg aagaggagga ggccaagatc cggcaaagga tcttcagacc aacaaggaaa
     2881 caacgcaagg aagaaagagc ttctctcggt ttagtcacag gttctgaaat taggaaaaga
     2941 aacccagaag acttcaagcc caaggggaaa ctatgggctg atgatgacag aagtgtggac
     3001 tacaatgaga aactcagttt tgaggccccg ccaagcatct ggtcaaggat agtcaacttt
     3061 ggttcaggtt ggggcttctg ggtctccccc agcttgttca taacatcaac ccacgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt acacaagtca
     3181 ggcgagttct gtcgcttgag attcccaaaa ccaatcagga ctgatgtgac tggcatgatc
     3241 ttggaagaag gtgcgcccga aggcaccgtg gccacactac tcatcaaaag gtccactgga
     3301 gaactcatgc ccctagcagc tagaatgggg acccatgcaa ccatgaaaat tcaagggcgc
     3361 actgttggag gtcagatggg catgcttctg acaggatcca acgccaaaag catggatcta
     3421 ggcaccacac caggtgattg cggctgtccc tacatctaca agagaggaaa tgactatgtg
     3481 gtcattggaa tccacatggc tgccgctcgt ggtggaaaca ctgtcatatg tgccacccag
     3541 gggggtgagg gggaagctac acttgaaggt ggtgacagta agggaacata ctgtggtgca
     3601 ccaatcctag gcccagggag cgccccaaaa cttagcacca aaaccaaatt ctggaggtcg
     3661 tccacagtac cgctcccacc tggcacctat gaaccagcct accttggtgg caaggacccc
     3721 agagtcaagg gtggcccctc gttgcagcaa gtcatgagag aacagctgaa accatttaca
     3781 gagcccaggg gtaagccacc aaagccaagt gtgttagaag ctgccaagaa aaccatcatc
     3841 aatgtccttg aacaaacaat tgacccacct gagaagtggt cgttcgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc tagcggccat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggagt ccttcacagg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaagggg agaacatgac cccagtttac acaggtgcac ttaaggatga attagtcaaa
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcgga tttagcaacc
     4141 atgatccggt gtgctcgagc attcggaggc ctaatggatg aactcaaagc acactgtgtc
     4201 acactgccta tcagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagaag
     4261 cattccaggt tcagatacca ctatgatgct gattactctc ggtgggattc aacacaacag
     4321 agggccgtgc tggcagctgc tctagaaatc atggttaaat tctcctcgga accacatttg
     4381 gctcaggtag tcgcagaaga ccttctttct cctagcgtgg tggatgtggg tgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatt
     4501 gcccactggc ttctcactct ctgtgcgctc tccgaagtta caaatttgtc cccagacatc
     4561 atacaggcta attctctctt ctccttctat ggtgatgatg aaattgttag tacagacata
     4621 aaactagacc cggagaagtt gacagcaaag cttaaggaat atgggttgaa accaacccgc
     4681 cctgataaaa ctgaagggcc tcttgttatt tctgaagact tggatggttt gactttcctg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggagca gagctcaata
     4801 ctcaggcaaa tgtactggac caggggcccc aaccatgagg acccatctga atcgatgatt
     4861 ccacactctc agagacccat acaattgatg tccttactgg gagaggccgc actccacggc
     4921 ccaacattct acagtaaaat cagcaaatta gtcattgcag agctaaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgaatga
     5101 cgccagccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgtcg gtgccgcaat tgcggcgcct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct agtggagagt tcacagtatc
     5281 ccctagaaac gctccaggcg aaatactgtg gagcgcgccc ttaggccctg atctgaatcc
     5341 ctacctatct catttggcca gaatgtataa tggttatgca ggtggttttg aagtgcaggt
     5401 gatcctcgcg gggaacgcgt tcaccgccgg aaaaattata tttgcagcag tcccaccaaa
     5461 ttttccaact gaaggcttga gccctagcca ggttaccatg ttcccccaca taatagtaga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacctgat gttaggaata acttctatca
     5581 ttataatcag tcaaatgatt ctaccattaa attgatagca atgctgtata caccacttag
     5641 ggctaataat gctggggaag atgtcttcac agtctcttgt cgagtcctca cgaggccatc
     5701 ccccgatttt gattttatat ttttggtgcc acctacagtt gagtcaagaa ctaaaccatt
     5761 cactgtccca atcctaactg ttgaagaaat gactaattca agattcccca ttcctttgga
     5821 aaagttgttc acgggtccca gcggcgcctt tgttgttcaa ccacaaaatg gcagatgcac
     5881 gactgatggc gtgctcctag gcaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggggacgtc acccacattg caggttctcg taactacaca atgaatttgg ctgctctgaa
     6001 ttggaacaat tatgacccaa cagaagaaat tccagcccct ctaggaaccc cagatttcgt
     6061 gggaaagatc caaggtgtgc tcactcaaac cacaaaggca gatggctcga cccgtggcca
     6121 taaagctaca gtttatactg ggagtgccga ctttactcca aagctgggca gtgttcaatt
     6181 cagtaccgat acagaaaatg attttgaaac tcaccaaaac acaaaattca ccccagtcgg
     6241 tgtcatccag gatggtagca ccacccatcg aaatgaaccc caacaatggg tgctcccgag
     6301 ttattcaggt agaaatgtcc ataatgtaca cctagcccct gctgtagccc ccacctttcc
     6361 gggtgaacaa cttcttttct tcaggtccac tatgcccgga tgcagcgggt atcccaacat
     6421 ggatttggat tgcctactcc cccaagagtg ggtgcagcac ttctaccaag aggcagctcc
     6481 agcacaatct gatgtggctc tattgagatt tgtgaatcca gacacgggta gggtcctgtt
     6541 tgagtgcaaa cttcataaat caggctatgt cacagtggct cacaccggcc agcatgactt
     6601 ggtcatcccc cccaatggct attttaggtt tgattcctgg gttaatcaat tctacacact
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcttta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttggctct ggacttggtt ccctgattaa tgctggggct
     6781 ggggctatca accaaaagat tgattttgaa aataatagaa aattgcagca agcttccttc
     6841 cagtttagca gtaatctaca acaggcttcc tttcaacatg acaaagagat gatccaagca
     6901 caaattgagg ccactaaaaa gttgcaacag gaaatgatga gagtcaaaca ggcaatgctc
     6961 ttagaaggtg gattctctga aacagatgca gcccgtgggg caatcaacgc ccccatgaca
     7021 aaggctttgg actggagcgg aacaaggtac tgggcccctg atgctaggac tacaacatac
     7081 aatgcaggcc gcttttcttc ccctcaacct tcgggggcac tgccaggaag aatcaatccc
     7141 agggctccca cccccgctcg gggctcctct aacacatctt ctaatgcttc tactgctact
     7201 tctatatatt caaatcaaac cgcttcaacg agacttggtt ctacagctgg ttctggcacc
     7261 aatgtctcga gtctcccgtc aactgcaagg actaggagtt gggttgagga tcaaaacaga
     7321 aatttgtcac ctttcatgag gggggctcac gacatatcgt ttgtcactcc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgggtgtaa
//