Typing tool

Complete norovirus genomes

MG002632  GII.4 Sydney
 GII.P4 New Orleans

Length: 7,550 | 3 CDS

ORF1: 6..5099
ORF2: 5080..6702
ORF3: 6702..7508
LOCUS       MG002632                7550 bp    RNA     linear   VRL 03-NOV-2017
DEFINITION  Norovirus GII strain
            Hu/GII.P4_New_Orleans2009_GII.4_Sydney2012/BNE3/2017/AU
            polyprotein, major capsid protein, and minor structural protein
            genes, complete cds.
ACCESSION   MG002632
VERSION     MG002632.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7550)
  AUTHORS   Huang,B., McMahon,J., Hewitson,G. and Warrilow,D.
  TITLE     Characterization of norovirus strains from cases in Brisbane,
            Queensland, Australia
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7550)
  AUTHORS   Huang,B., McMahon,J., Hewitson,G. and Warrilow,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-SEP-2017) Public Health Virology, Forensic and
            Scientific Services, 39 Kessels Road, Coopers Plains, Queensland
            4108, Australia
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8.1
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7550
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P4_New_Orleans2009_GII.4_Sydney2012/BNE3/2
                     017/AU"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Australia"
                     /collection_date="14-Jul-2017"
                     /note="genotype: GII.P16_GII.4"
     CDS             6..5099
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ATL14559.1"
                     /translation="MASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARPKQ
                     PPPREKPQRPPRPPTPELVKDIPPPPPNGEDEIVVSYSVKNGVSGLPDLSTVRQPEES
                     NTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAISLA
                     KVELAPLSLYWRPVYTPQYLISPDTLKKLSGETFPYTAFDNNCYAFCCWVLDLNDSWL
                     SRRMIQRTTGFFRPYQDWNRKPLPTMDDSKIKKVANIFLCALSSLFTRPIKDIIGKIR
                     PLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPEDLA
                     VELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFPKK
                     EEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLSTKS
                     ASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREVAK
                     RIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTCPL
                     TLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEKAK
                     RDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARASG
                     LLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVRTMPE
                     LKQALKNVSIKKCQIVYSGCTYMLESDGKGNVKVDRIQSAAVQTNNELAGALHHLRCA
                     RIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQDLWSKPQVENTEETTSKDGCPK
                     PKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKY
                     SIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERVSLGLVTG
                     SEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSPSL
                     FITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEGTV
                     VTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGDCG
                     CPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILGPG
                     SAPTLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEPRG
                     KPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCWNG
                     ESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDLAT
                     MIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWDST
                     QQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQ
                     WNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLREY
                     GLKPTRPDKTEGPLAISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNH
                     GDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPM
                     FRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5080..6702
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ATL14560.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSIPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSHNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFETDTSNDFEASQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPTVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKAGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRVV"
     CDS             6702..7508
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="ATL14561.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKVLDWSGTRYWAPDARTTTYNAGRFSTPQSPGALPGRANLRDAVPARGSSSKSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPPSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 tgaagatggc gtctaacgac gcttccgctg ccgctgttgc caacagcaac aacgacaccg
       61 caaaatcttc aagtgacgga gtgctttcta gcatggctgt cacttttaaa cgagccctcg
      121 gggcgcggcc caaacagcct cccccgaggg aaaaaccaca aagaccccca cgaccaccca
      181 ctccagaact ggttaaggat atcccccctc ccccacccaa cggggaggat gaaatagtgg
      241 tctcttatag tgtcaaaaat ggtgtttccg gcttgcctga cctttctacc gtcaggcaac
      301 cggaagaatc caacacggct ttcagtgtcc ctccactcaa tcagagggag aatagagatg
      361 ctaaggaacc actcactgga acaattttgg aaatgtggga cggggaaatc taccattatg
      421 gcctgtatgt ggaacgaggt cttgtgctag gtgtgcacaa accgccagct gccatcagcc
      481 ttgctaaggt tgagctggca ccactctcct tgtactggag acctgtgtac actcctcagt
      541 acctcatctc tccagacact ctcaagaaat tgtccggaga gacgttcccc tacacagcct
      601 ttgataataa ctgctatgcc ttttgttgct gggttctgga cctaaatgac tcgtggctga
      661 gtagaagaat gatccagaga acaactggtt tctttaggcc ctatcaggac tggaatagga
      721 aaccccttcc tactatggat gactccaaaa taaagaaggt agctaacata tttctgtgtg
      781 ccctgtcctc gctattcacc agacccataa aagatataat agggaagata aggcctctta
      841 acatcctcaa catcttggcc tcatgtgact ggacctttgc gggtatagtg gagtccctga
      901 tactcttggc agaactcttt ggagttttct ggacaccccc agatgtgtct gcgatgattg
      961 cccccttact tggtgactat gagctacaag gacctgagga ccttgcagta gagctcgtcc
     1021 ccgtggtgat ggggggaatt ggtttggtgc taggattcac caaagagaaa attggaaaaa
     1081 tgttgtcatc tgctgcgtcc actttgagag cttgcaaaga ccttggtgca tatgggctag
     1141 agatcctaaa gttagtcatg aagtggttct tcccaaagaa ggaggaggca aatgaactgg
     1201 ctatagtgag gtccatcgag gacgcagtcc tggatctcga ggcaattgaa aacaatcata
     1261 tgaccacctt gcttaaagat aaagacagtc tggcaaccta catgagaaca cttgaccttg
     1321 aagaggagaa agccagaaaa ctctcaacca agtctgcctc acccgacatc gtgggtacaa
     1381 tcaacgccct cctggcgaga atcgctgccg cacgctctct ggtgcatcga gcgaaagagg
     1441 agctttccag cagaccaaga cctgtggtgt tgatgatatc tggcaggcca ggaataggga
     1501 agacccacct tgctagggaa gtggctaaga gaatcgcagc ctcccttaca ggagatcagc
     1561 gtgtgggcct catcccacgc aatggtgtcg accattggga tgcgtacaag ggggagaggg
     1621 tcgtcctgtg ggacgattat ggaatgagca accctattca cgatgccctc aggctgcaag
     1681 aactcgctga cacttgtccc ctcactctga actgtgacag gattgaaaat aaaggaaagg
     1741 tctttgacag cgatgtcatc attatcacca ctaatctggc caacccagca ccactggact
     1801 atgtcaactt tgaagcatgc tcgaggcgca ttgacttcct cgtgtatgca gaagcccctg
     1861 aagttgaaaa ggcgaagcgt gacttcccag gccagcctga catgtggaag aacgctttca
     1921 gttctgattt ctcacacata aaactagcac tggccccaca gggtggtttc gataagaacg
     1981 ggaacacccc acacggaaag ggcgtcatga agaccctcac cactggctcc cttattgccc
     2041 gagcatcagg gctgctccat gagagactgg atgaatttga gctgcagggc ccagctctca
     2101 ccaccttcaa cttcgatcgc aataaagtgc ttgcctttag acagcttgct gctgaaaaca
     2161 aatatggatt gatggacaca atgagggttg ggaaacagct caaggatgtc agaaccatgc
     2221 cagaactcaa acaggcactc aaaaatgtct caatcaagaa gtgccaaata gtgtatagtg
     2281 gttgcactta catgcttgag tctgatggca agggcaatgt gaaggttgac agaatccaaa
     2341 gcgccgccgt gcagaccaac aatgagctgg ctggtgccct gcaccacttg aggtgcgcca
     2401 gaatcagata ctatgtcaag tgtgtccagg aagccctgta ttccatcatc caaatcgctg
     2461 gggctgcatt tgtcaccacg cgcattgcca agcgcatgaa catacaagac ctatggtcca
     2521 agccacaagt ggaaaacaca gaggagacta ccagcaagga cgggtgccca aagcctaagg
     2581 atgatgagga gttcgtcatt tcatccgacg acatcaaaac tgagggcaag aaggggaaga
     2641 acaagactgg ccgtggcaag aagcacacag cattttcaag caaaggcctc agtgatgaag
     2701 agtatgatga atacaagagg attagagaag agaggaatgg caagtactct atagaagagt
     2761 accttcagga cagggacaaa tactatgagg aggtggctat tgccagggcg accgaggaag
     2821 acttctgtga agaggaggag gccaagatcc gacaaaggat ctttaggcca acaaggaaac
     2881 aacgcaagga ggaaagagtc tctcttggtc tggtcacagg ctctgaaatt aggaaaagaa
     2941 acccagatga cttcaaaccc aagggaaaat tgtgggctga cgatgacagg agtgtggact
     3001 acaatgagaa actcagcttt gaggccccac caagcatttg gtcgagaata gtcaactttg
     3061 gttcaggctg gggattctgg gtctctccca gtttgttcat aacatcaaca catgtcatac
     3121 cccagggcgc aaaggagttc tttggagtcc ccatcaaaca aatacaggta cacaagtcag
     3181 gcgagttctg tcgcttgaga tttcctaaac caatcaggac tgatgtaacg ggcatgatct
     3241 tggaagaagg cgcacctgag ggcaccgtgg tcacactact catcaaaagg cccactgggg
     3301 aactcatgcc cctagcagct aggatgggga cccatgcgac catgaagatc caagggcgca
     3361 ctgttggagg ccagatgggc atgcttctga caggatccaa cgccaagagc atggacctgg
     3421 gtactacacc aggtgattgt ggctgcccct acatctacaa gagaggcaat gactatgtgg
     3481 tcattggagt ccacacggct gccgcacgtg ggggaaacac tgtcatatgt gccacccaag
     3541 ggagtgaagg ggaggctaca cttgagggtg gtgacaacaa ggggacatac tgtggtgcac
     3601 caatcctggg tccagggagt gccccaacac ttagcaccaa gaccaaattc tggagatcgt
     3661 ccacagcacc acttccacct ggcacctatg aaccagccta tcttggtggc aaggacccta
     3721 gagtcaaggg tggcccttca ctgcagcaag tcatgaggga acagttgaag ccattcacag
     3781 agcccagggg caagccacca aaaccaagtg tgttggaagc tgccaagaag accatcatta
     3841 atgtccttga acaaacaatt gacccacctg agaaatggtc gttcgcacaa gcttgcgcgt
     3901 cccttgacaa gaccacttcc agtggccatc cgcaccatat gcggaaaaac gactgctgga
     3961 acggggaatc ctttacgggc aagctggcag accaagcttc caaggccaac ctgatgtttg
     4021 aagaagggaa gaacatgacc ccagtctaca cagctgcgct caaggatgag ttagttaaaa
     4081 ctgacaaaat ttatggtaag atcaagaaga ggcttctctg gggctcggat ttggcaacca
     4141 tgattcggtg tgctcgagca ttcggaggcc taatggatga actcaaagcg cactgtgtca
     4201 cactccccat tagagttggc atgaatatga atgaggatgg ccccatcatc ttcgagaggc
     4261 attccaggta cacgtaccac tatgatgctg actactctcg gtgggattca acacaacaga
     4321 gagccgtgtt ggcagcagct ctagaaatca tggttaaatt ctccccagaa ccacatttgg
     4381 ctcaggtggt cgcggaagac cttctttccc ccagcgtggt ggacgtgggc gacttcacaa
     4441 tatcaatcaa tgagggtctt ccctctgggg tgccctgcac ctcccaatgg aactccattg
     4501 cccactggct cctcaccctc tgtgcgctct ctgaagtcac aaacctgtcc cctgatacca
     4561 tacaggctaa ttccctcttc tctttttatg gtgatgatga aattgttagc acagacataa
     4621 aattggaccc agagaaattg acagcaaaac tcagagagta tgggttaaaa ccaacccgcc
     4681 ctgacaaaac tgaaggaccc cttgccatct ctgaagacct gaatggtctg actttcctgc
     4741 ggagaactgt aacccgcgac ccagctggtt ggtttggaaa actggagcag agttcaatac
     4801 tcaggcaaat gtactggact aggggtccca accatggaga cccatctgaa acaatgattc
     4861 cacactccca aagacccata cagttgatgt ccctactggg ggaggccgct ctccacggcc
     4921 cagcatttta cagcaaaatt agcaaattgg tcattgcaga gctaaaagaa ggtggcatgg
     4981 atttttacgt gcccagacaa gagccaatgt tcagatggat gagattctca gatctgagca
     5041 cgtgggaggg cgatcgcaat ctggctccca gttttgtgaa tgaagatggc gtcgagtgac
     5101 gccaacccat ctgatgggtc cgcagccaac ctcgtcccag aggtcaacaa tgaggttatg
     5161 gctctggagc ccgttgttgg tgccgctatt gcggcacctg tagcgggcca acaaaatgta
     5221 attgacccct ggattaggaa taattttgta caagcccctg gtggagagtt tacagtatcc
     5281 cctagaaacg ctccaggtga aatactatgg agtgcaccct taggccctga tctaaatccc
     5341 tacctatccc atttggccag aatgtacaat ggttatgcag gtggttttga agtgcaggta
     5401 attctcgcgg ggaacgcgtt caccgccggg aaggtcatat ttgcagcagt cccaccaaat
     5461 ttcccaactg aaggcttaag ccccagccag gtcactatgt tcccccacat agtagtagat
     5521 gttaggcaac tagaacctgt gttgattccc ttacccgatg ttaggaacaa tttctaccat
     5581 tataaccaat caaatgaccc cactattaag ttgatagcaa tgttgtatac accacttagg
     5641 gctaataatg ctggggacga tgtcttcaca gtttcttgcc gagttctcac aagaccatcc
     5701 cccgattttg atttcatatt tttagtacca cccacagttg agtcaagaac taaaccattc
     5761 tctatcccag ttttaacagt tgaggagatg accaattcaa gattccccat tcctttggaa
     5821 aagttgttca cgggtcccag cagcgccttt gttgttcaac cacaaaacgg cagatgcacg
     5881 actgatggcg tgctcctagg caccacccaa ctgtctcctg taaacatctg caccttcaga
     5941 ggggacgtca cccacatcac aggcagtcac aactacacaa tgaatttggc ttctcaaaat
     6001 tggaacaatt acgatccaac agaagaaatc ccagcccctc taggaacccc agactttgtg
     6061 gggaagattc aaggtatgct cacccaaacc acaagggcag atggctcaac acgcggccac
     6121 aaggctacag tgtacactgg gagcgccgac tttgctccta aactgggtag agttcaattt
     6181 gaaactgaca caagcaatga ttttgaagct agccaaaaca caaagttcac cccagtcggt
     6241 gtcatccaag acggtagcac cacccaccga aatgaacccc aacagtgggt gctcccaagt
     6301 tactcaggca gaaatactca taatgtgcat ctggccccca ctgtggcccc cactttcccg
     6361 ggtgagcaac ttctcttctt cagatccacc atgcccggat gcagcgggta ccctaacatg
     6421 gatttggact gtctactccc tcaggaatgg gtgcagcact tctaccaaga ggcagcccca
     6481 gcacaatctg atgtggctct gctaagattt gtaaatccag acacaggtag ggttttgttt
     6541 gagtgcaagc tccataaagc aggctatgtc acagtggctc acactggcca acacgatttg
     6601 gtcatccccc ccaatggtta ttttaggttt gattcttggg tcaaccagtt ctacacgctt
     6661 gcccccatgg gaaatggaac ggggcgtaga cgtgtagtat aatggctgga gctttctttg
     6721 ctggattggc atctgatgtc cttggctctg gacttggttc ccttatcaat gctggggctg
     6781 gggccatcaa ccaaaaagtt gagtttgaaa acaacagaaa attgcaacaa gcatcattcc
     6841 aatttagcag caatctgcaa caggcttcct ttcaacatga taaagagatg ctccaagcac
     6901 aaattgaggc taccaaaaag ctacaacagg aaatgatgaa agttaagcag gcaatgctcc
     6961 tagagggtgg attctctgag acagatgcag cccgcggggc aattaacgcc cccatgacaa
     7021 aagttttgga ctggagcggg accaggtact gggctcccga tgctagaact acaacataca
     7081 atgcaggccg cttttccacc cctcaatcac caggggcact gccaggaaga gctaatctta
     7141 gggatgctgt ccctgctcgg ggttcctcca gcaaatcatc taactcttct actgctactt
     7201 ctgtgtattc aaatcaaact acttcaacga gacttggttc tacagctggt tctggtacca
     7261 gtgtctcgag tctcccgtca actgcaagga ctaggagctg ggttgaggat caaagcagga
     7321 atttgtcacc tttcatgagg ggggcccaca acatatcgtt tgtcacccca ccacctagca
     7381 gatcctctag ccaaggcaca gtctcaaccg tgcctaaaga gattttggac tcctggactg
     7441 gcgctttcaa cacgcgcagg cagcctctct tcgctcacat tcgtaaacgg ggggagtcac
     7501 gggtgtaatg tgaaaagaca aaattgatta tctttctttt tctttagtgt
//