Typing tool

Complete norovirus genomes

MF918359  GII.17
 GII.P17

Length: 7,565 | 3 CDS

ORF1: 10..5112
ORF2: 5093..6715
ORF3: 6715..7494
LOCUS       MF918359                7565 bp    RNA     linear   VRL 11-OCT-2017
DEFINITION  Norovirus GII.17 strain GII.17/GX213/CHN/2015, complete genome.
ACCESSION   MF918359
VERSION     MF918359.2
KEYWORDS    .
SOURCE      Norovirus GII.17
  ORGANISM  Norovirus GII.17
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7565)
  AUTHORS   Xin,Y., Ao,Y., Li,L., Yu,J., Li,J., Lin,L. and Zhang,B.
  TITLE     The discovery and gene sequence analysis of GII.17 norovirus in
            Rhesus Monkeys of Guangxi
  JOURNAL   Zhonghua Shi Yan He Lin Chuang Bing Du Xue Za Zhi (2017) In press
REFERENCE   2  (bases 1 to 7565)
  AUTHORS   Xin,Y., Ao,Y., Li,L., Yu,J., Li,J., Lin,L. and Zhang,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-SEP-2017) The First Affiliated Hospital of Hunan
            Normal University, Pediatrics, Hunan People's Hospital, Jiefangxi
            Street, Furong district, Changsha, Hunan 410005, China
REFERENCE   3  (bases 1 to 7565)
  AUTHORS   Xin,Y., Ao,Y., Li,L., Yu,J., Li,J., Lin,L. and Zhang,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2017) The First Affiliated Hospital of Hunan
            Normal University, Pediatrics, Hunan People's Hospital, Jiefangxi
            Street, Furong district, Changsha, Hunan 410005, China
  REMARK    Nucleotide and amino acid sequences updated by submitter
COMMENT     On Oct 11, 2017 this sequence version replaced MF918359.1.
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqMan v. 7
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7565
                     /organism="Norovirus GII.17"
                     /mol_type="genomic RNA"
                     /strain="GII.17/GX213/CHN/2015"
                     /isolate="GX213"
                     /host="Rhesus monkey"
                     /db_xref="taxon:552592"
                     /country="China"
                     /collection_date="2015"
                     /note="genotype: GII.17"
     CDS             10..5112
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ATE49950.2"
                     /translation="MASNDASAAVAGKNNNNDKEKSSSDSLFANMSVTFKKALGARSK
                     QPPPGETKQIQKPPRPPTPELVKRIPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVVQP
                     DAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPAAI
                     SLAKIEITPLSLYWRVVYTPQYLIDPGTLKNLSGETFPYTAFDNNCYAFCCWVLDLND
                     SWLSRRMIQRTTGFFKPYQDWNRKPLPTMDEPKIKKAADAVLCALSSLFTRPIKDIIG
                     KLRPLNILNILATCDWTFAGTVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACRDLGSYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYIRTLDLEEEKARKLS
                     TKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLARE
                     LAKKVASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELADT
                     CPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDIE
                     KAKRDFPGQPDMWKDHFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLIAR
                     ASGLLHERKDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSVKT
                     LDELKQAIKNISIKKCQIVYNGCTYTMESDGRGKVVVEKVQNATVQTNNELVGVLHHL
                     RSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDEPEDRGG
                     CPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERN
                     GKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGL
                     VTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFWVS
                     PSLFITSTHVIPEGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGAPE
                     GTVVSVLIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDLVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPIL
                     GPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTE
                     PRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKNDY
                     WSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWGSD
                     LSTMIRCARAFGGLMDEFKANCITLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRW
                     DSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWTRG
                     PNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVPRQ
                     ESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5093..6715
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="ATE49951.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVSIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLPSGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
                     VSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
                     DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
                     CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV
                     VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     CDS             6715..7494
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="ATE49952.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDKEMLQAQVRATKQLQSEMIALKQGVLAAGGFSPTDAARGSIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMSSPNAPQSKPAKPRSLAPSSPSSSVYSMYTQST
                     HLTSGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISQVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN      
        1 tctttgaaga tggcgtctaa cgacgcttcc gctgccgttg ctggcaaaaa caacaacaac
       61 gacaaggaaa aatcttcaag tgacagcttg tttgctaaca tgtctgtcac ttttaagaaa
      121 gccctcgggg cgcggtctaa acaaccgccc ccgggagaaa caaaacaaat acaaaaacca
      181 ccaaggccac cgacaccgga attggtgaag agaatacctc cacccccacc caatggcgag
      241 gatgaaccag ggatagtgta caaggtggga gagggtgtgt ctgggctgcc cgacctaaca
      301 actgtggtac aacctgacgc acaaaacaca gcttatagtg ttcccccact tagccagaga
      361 gaagtcggcg aagctaaaga accgctgcct ggctccattc tggaaatgtg ggatggtgag
      421 atctaccact atgggctgta tgttgagcgg gggcatgtgc tcggagtaca caaaccacct
      481 gctgcaataa gccttgccaa aattgaaata acaccgctgt ctctctactg gagagtggtc
      541 tacactcccc agtatttgat agatccagga actcttaaga acttgagtgg agagactttc
      601 ccatacacgg cctttgacaa caactgttat gccttctgtt gttgggtcct agacctcaac
      661 gactcctggc ttagcaggag aatgatccaa agaacaactg gattcttcaa accttatcag
      721 gattggaaca gaaaaccctt accaaccatg gatgaaccga aaatcaagaa ggccgcggat
      781 gctgtcctat gcgctctctc ctcactcttc actagaccca ttaaggacat cattggaaag
      841 cttagaccac tgaacattct taatatactg gcaacctgcg attggacttt tgcaggcaca
      901 gtggagtcct tgatccttct tgctgaactc tttggggtgt tctggacacc cccagatgtg
      961 tctgcgatga ttgctccctt actcggtgac tacgagatgc aaggccccga agacctggcc
     1021 gtggaacttg tgcccgtggt gatgggagga ataggtttgg tgttaggatt caccaaagaa
     1081 aagatcggca agatgctttc atcggctgcg accacactta gggcctgcag ggatctagga
     1141 tcttatggat tggagatact caaactggtc atgaagtggt tcttccccaa gaaggaggag
     1201 gctaacgaac tagccatggt gagggccatt gaggatgcag tcctggattt ggaggcaata
     1261 gaaaacaatc acatgaccac ccttctcaag gataaagaca gcctagccac atacattagg
     1321 actcttgact tggaagaaga gaaagcaagg aaactgtcaa ccaaatcggc gtcacctgac
     1381 atcgtgggta caataaacgc attattggct aggatagcag ccgccaggtc actggtccac
     1441 aaggctaagg aggagctctc gagcagacag agacctgttg ttgtaatgat atcaggtaga
     1501 ccaggtatag gaaagaccca tctggccaga gagctagcca agaaagttgc gtcaacactg
     1561 tcaggcgacc aaaggattgg actggtacct agaaatggcg tcgaccattg ggacgcctac
     1621 aagggagaaa gggtggttct gtgggatgat tatggtatga gcaaccctat acaggacgca
     1681 ctgaggctcc aagaattggc tgacacctgt cctctgaccc taaattgtga taggattgaa
     1741 aacaaaggaa aagtgttcga cagtgatgcc ataattataa caaccaacct tgcaaaccca
     1801 gcaccactag actatgtcaa ctttgaggcc tgctctagac gcatagactt cttggtgtat
     1861 gcagacgcac ctgacattga gaaggctaag cgtgacttcc ctggccaacc agatatgtgg
     1921 aaagaccatt tcaagccaga cttctcacac attaaacttc agctggcacc acagggaggt
     1981 tttgacaaaa atggcaacac cccacatggc aaaggtgtgg tgaagtccct gacgattggt
     2041 tctctgatcg ccagggcctc cggcttgctc cacgagagaa aggatgaatt cgagctccaa
     2101 ggctctgacc tgccaacctt caattttgac cgcaacaaag tcgccgcctt cagacaatta
     2161 gcagctgaaa acaaatatgg tcttatggac acactgaggg tcggcaacca actgaaaagt
     2221 gttaagaccc tggatgagct gaagcaggcc ataaagaaca tcagtatcaa gaagtgtcag
     2281 atagtgtata atggatgcac ctataccatg gaatctgatg ggaggggcaa ggttgtggtt
     2341 gaaaaggtac aaaacgcaac agttcaaacc aacaatgaac ttgtaggggt gctccaccac
     2401 ctgagatctg caaggataag atactatgtt aaatgtttcc aagaagccat ttactctcta
     2461 ctccaaattg ctggtgcagc cttcgtcacc tcacgcatcg tgaggcgcat gaacatatca
     2521 aacctctggt cgaagccacc catcgaggag ggtgatgagc ctgaagacag aggaggatgc
     2581 cccaagccca gggatgaaga tgacctcact attgactcta gagacattaa agtggaaggg
     2641 aagaagggca agaacaagtc tggccggggc aagaaacaca cagccttctc ttccaagggc
     2701 ctcagtgatg aagagtacga tgagtacaag agaatcagag aggagaggaa tggcaaatac
     2761 tcaatagagg agtacctcca agatagggac agatactatg aagagcttgc cattgctaag
     2821 gccactgagg aggacttctg tgaggaggag gagattaaaa tccgccagag aatcttccga
     2881 cccaccagga agcagcggaa agaggaaagg gccacgcttg ggcttgtcac aggatcggaa
     2941 atcagaaaga ggaatccaga tgactttaaa ccaaagggaa aattgtgggc tgatgacaac
     3001 aggagcgtgg attacaatga gaggatagat tttgaggctc ccccgagtgt ttggtctagg
     3061 atagtcaact ttggcacagg ctggggattc tgggtttctc caagtctctt tataacttca
     3121 acacacgtca taccagaagg aatcactgag gcctttggag tgcccataaa ccaaatccaa
     3181 attcacaaat ctggagaatt ttgccgcttg cggtttccaa agccaattag accagacgtg
     3241 agtgggatga tcttggaaga gggcgcccct gaaggcactg ttgtgtctgt tctcatcaaa
     3301 aggacaacag gggagctgat gcctcttgca gtcagaatgg ggactcatgc cacaatgaaa
     3361 atccaaggta gaacggtggg tggtcagatg ggtatgcttc tcactggctc aaatgctaaa
     3421 agcatggatc taggcacaac gccaggtgac tgcgggtgtc catacatata caaaaggggc
     3481 aatgaccttg tggtcattgg ggtgcacact gcagcagctc gtggaggcaa cacggtcata
     3541 tgtgccacac agggaagtga aggtgaagcc actcttgaag gaggtgacaa caagggtacc
     3601 tattgtggag cccccatttt gggacctggc aatgcaccaa aattgagcac aaagacaaaa
     3661 ttctggagat cctctaacgc accgcttccc ccaggtactt atgaaccagc ataccttggt
     3721 gggagagacc cgcgcgtgaa gggaggccca tctctgcaac aagttatgag agaccaactt
     3781 aaacctttta cagagcccag agggaagcca ccaaacccaa atgtcttaga gtcagcaaag
     3841 aagactatca tcaatgttct ggaacaaacc attgaccccc ctcaaaagtg gtcatatgcc
     3901 caagcttgtg catccctcga caagacaacc tccagtggat acccgcacca cgtccggaag
     3961 aatgactatt ggagtggtga atccttcaca ggaaaacttg cagatcaggc ttcaaaagca
     4021 aatctcatgt atgaggaagg caagcacatg caaccagttt acaccgcagc actcaaagac
     4081 gagctcgtga aaactgacaa aatttatggc aaaatcaaga aaagactcct gtggggttct
     4141 gacctctcca caatgattcg atgcgccaga gcatttggtg gtctcatgga tgaattcaaa
     4201 gcaaattgta ttacactccc tatcagagtt ggtatgaata tgaatgaaga tggtcccata
     4261 atatttgaga gacactccag gtacaggtac cactatgatg ctgattactc ccgctgggac
     4321 tccacacaac agcgggcagt gctggaagcg gcacttgaaa tcatggtgag attttctgct
     4381 gagccacagc tggcacaaat agtggcagag gacctgctgt caccaagtgt ggttgatgtg
     4441 ggtgatttca aaatcgctat caatgaaggc ctaccatctg gcgtgccttg cacctcacaa
     4501 tggaattcta ttgcccactg gttacttacc ttgtgtgccc tttctgaagt gacaggatta
     4561 ggtcctgaca tcatacaagc taactccatg tactctttct atggtgatga tgagattgtg
     4621 agcacagaca taaaattgga cccagagaaa ttgaccgcaa agctcaaaga atatggcctt
     4681 aaacccactc ggcccgacaa aactgagggg ccgttggtga ttagtgagga cctgaatggg
     4741 ttgactttcc tccgccgaac agtcacccgt gatccagcag gttggtttgg aaagttggac
     4801 caaaactcca tcctcaggca gttgtactgg acaagaggac ccaaccatga agaccccagt
     4861 gagaccatga taccacacgc acaaagacct gtgcagctca tggcactact aggagaatcc
     4921 tccctacatg gaccctcatt ttacagcaag gttagcaaat tagtcatatc tgaacttaaa
     4981 gagggaggaa tggattttta tgtgcccaga caagagtcaa tgttcagatg gatgaggttc
     5041 tcagatctaa gcacatggga gggcgatcgc aatctggctc ccagttttgt gaatgaagat
     5101 ggcgtcgaat gacgccgctc catctaatga tggtgctgct ggtctcgtac cagagggcaa
     5161 caacgagacc cttcccctag aaccagttgc gggcgcagct atagccgcac ccgtcactgg
     5221 ccaaaataac ataattgacc cctggattag aacaaacttt gtgcaagcac caaatggaga
     5281 gttcacagtg tcacccagaa actctcctgg agaaatttta ttaaacttag agttgggccc
     5341 tgatttgaac ccttatttgg ctcatttgtc aaggatgtat aatgggtatg ctggtggagt
     5401 ggaagttcag gttctcctgg cagggaacgc gttcactgcc gggaagatcc tcttcgccgc
     5461 cgtcccgcca aatttcccag tggaattctt aagcccagcc cagattacaa tgctcccaca
     5521 tttaatagta gatgttagga ctcttgaacc aattatgatc ccactccctg atgttaggaa
     5581 tacattcttc cattatagta accagcctaa cagccgcatg agattagtgg ctatgctcta
     5641 taccccactc agatctaatg gctcaggtga tgatgtcttt actgtctctt gcagggtttt
     5701 gactaggcct actcctgatt ttgagttcac ttatttagtg ccaccttctg ttgaatctaa
     5761 aaccaagcct ttttccttgc ctattttaac cctttctgag ctcacaaatt cgaggttccc
     5821 agtctccatc gattcgcttt tcaccgccca gaataatgtg ttgcaggtgc agtgtcaaaa
     5881 tggcaggtgc acacttgatg gtgagttaca aggcacaact cagttgctcc catctggcat
     5941 ctgtgcattc agaggacggg tgacagcaca aattaaccaa cgtgacaggt ggcacatgca
     6001 actgcaaaac ctcaatggta caacatatga cccaactgat gatgtgccag ccccgctggg
     6061 tacacctgac ttcaagggcg tcgtgtttgg gatggtaagc caaagaaatg tgggtaatga
     6121 tgcgcctggc tcaaccagag cccaacaggc gtgggtttca acctatagcc cccaatttgt
     6181 ccccaaatta ggttctgtca atcttagaat tagtgataat gatgatttcc aattccagcc
     6241 gacaaaattc acaccagtgg gcgtcaatga tgacgatgat ggccacccgt tcagacaatg
     6301 ggaactacca aactattcag gggagcttac cttgaatatg aatcttgccc ccccagttgc
     6361 tccaaatttt cctggtgaac aattgttatt cttcagatct ttcgtgccat gctcaggagg
     6421 ttacaaccaa ggtattatag attgtcttat tccccaagaa tggatccaac acttctatca
     6481 ggaatcagca ccctcccagt cagacgtggc cctaatcagg tatgtcaacc ccgatacggg
     6541 acgtacactg tttgaagcaa aattgcacag atctggttac attactgtgg ctcactctgg
     6601 agactatcct cttgttgttc cggctaatgg acactttaga tttgattctt gggtaaatca
     6661 gttttactca ctcgccccaa tgggaactgg gaatgggcga aggagggctc agtaatggct
     6721 ggggctttca ttgcaggatt ggcaggcgac atgctcacgt catctgtggg ctcccttgtg
     6781 aacgcagggg caaacgccat caaccaaaag atagactttg aaaacaacaa acaactccag
     6841 tctgcttcct ttcagcatga taaagagatg ctccaagcgc aggtgagggc aaccaagcag
     6901 ctgcaatctg aaatgatagc cctaaaacag ggggttttgg ccgcaggcgg cttttccccc
     6961 actgatgcag caaggggatc cattggtgca cccatgacaa aggtgcttga ctggtctggc
     7021 actcgatact gggcgcccaa ttccacaaag acaactggct attcgggaca attcacctct
     7081 tcacctgtgc atatgtctag cccaaatgct ccacaatcaa aacctgcaaa gcctaggtct
     7141 ctagctcctt cctctccttc tagcagtgtc tatagtatgt atactcaatc tactcattta
     7201 acatctggct cttctagtaa tgcttcttct gcctccacaa aattgacaaa cttaagctct
     7261 ggctcctccc aaaacagaac agcagagtgg gtaaatcaac agagaagtct tagccctttc
     7321 atgagtggcg cacttaacat ctcacaagtc acgccaccct caagtagggc ttccagttct
     7381 gggacggtct cgaccgtgcc caaggaagtt ttggactcct ggacgtctgc gtttaacaca
     7441 cacagacagc cgctcttcgc acacctcaga gtgagggggg agtcacgtgt ttagtgaaaa
     7501 gaaataattg gctataatgt gatttctttc taaatttggc taatttgtat cttttaaaaa
     7561 aaaaa
//