Typing tool

Complete norovirus genomes

MF421542  GII.17
 GII.P17

Length: 7,530 | 3 CDS

ORF1: 1..5109
ORF2: 5090..6712
ORF3: 6712..7491
LOCUS       MF421542                7530 bp    RNA     linear   VRL 19-FEB-2019
DEFINITION  Norovirus Hu/GII.17/WH2017-170/CHN/2017 nonstructural polyprotein,
            capsid protein VP1, and capsid protein VP2 genes, complete cds.
ACCESSION   MF421542
VERSION     MF421542.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.17/WH2017-170/CHN/2017
  ORGANISM  Norovirus Hu/GII.17/WH2017-170/CHN/2017
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7530)
  AUTHORS   Zhou,X., Kong,D.-G., Li,J., Pang,B.-B., Zhao,Y., Zhou,J.-B.,
            Zhang,T., Xu,J.-Q., Kobayashi,N. and Wang,Y.-H.
  TITLE     An Outbreak of Gastroenteritis Associated with GII.17
            Norovirus-Contaminated Secondary Water Supply System in Wuhan,
            China, 2017
  JOURNAL   Food Environ Virol (2019) In press
  REMARK    Publication Status: Available-Online prior to print
            DOI: 10.1007/s12560-019-09371-7
REFERENCE   2  (bases 1 to 7530)
  AUTHORS   Zhou,X., Wang,Y.H., Kong,D.G., Kobayashi,N., Pang,B.B. and Xiong,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUL-2017) Division of Microbiology, Wuhan Centers for
            Disease Prevention & Control, Jianghan North Road 24#, Wuhan, Hubei
            430015, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7530
                     /organism="Norovirus Hu/GII.17/WH2017-170/CHN/2017"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.17/WH2017-170/CHN/2017"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:2203780"
                     /country="China"
                     /collection_date="08-May-2017"
                     /note="genotype: GII.17"
     CDS             1..5109
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AWS05204.1"
                     /translation="MKMASNDASAAVAGKNNNNDKEKSSSDSLFANMSVTFKKALGAR
                     SKQPPPGETKQIQKPPRPPTPELVKRIPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVV
                     QPDAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPA
                     AISLAKIEITPLSLYWRVVYTPQYLIDPGTLKNLSGETFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRMIQRTTGFFKPYQDWNRKPLPTMDETKIKKAANAVLCALSSLFTRPIKDI
                     IGKLRPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQG
                     PEDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKW
                     FFPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARK
                     LSTKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLA
                     RELAKKVASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     IEKAKRDFPGQPDMWKDHFRPDFSHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLI
                     ARASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSV
                     KTLDELKQAIKNISIKKCQIVYNGCTYTMESDGRGKVVVEKVQNATVQTNNELVGALH
                     HLRSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDGPEDR
                     GGCPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREE
                     RNGKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATL
                     GLVTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFW
                     VSPSLFITSTHVIPKGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGA
                     PEGTVVSILIKRTTGELMPLAVRMGTHATLKIQGRTVGGQMGMLLTGSNAKSMDLGTT
                     PGDCGCPYMYKRGNDLVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKN
                     DYWSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWG
                     SDLSTMIRCARAFGGLMDEFKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYS
                     RWDSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWT
                     RGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVP
                     RQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5090..6712
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AWS05205.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLPSGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
                     VSQRNVGSDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
                     DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
                     CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV
                     VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     CDS             6712..7491
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="AWS05206.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDKEMLQAQVRATKQLQSEMIALKQGVLAAGGFSPTDAARGSIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMSSPNAPQSKPAKPRSLAPSSSSSSVYSMYTQST
                     HLTSGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgttgctg gcaaaaacaa caacaacgac
       61 aaggaaaaat cttcaagtga cagcttgttt gctaacatgt ctgtcacttt taagaaagcc
      121 ctcggggcgc ggtctaaaca accgcccccg ggagaaacaa aacaaataca aaaaccacca
      181 aggccaccga caccggaatt ggtgaagaga atacctccac ccccacccaa tggcgaggat
      241 gaaccaggga tagtgtacaa ggtgggagag ggtgtgtctg ggctgcccga cctaacaact
      301 gtggtgcaac ctgacgcaca aaacacagct tatagtgttc ccccacttag ccagagagaa
      361 gtcggcgaag ctaaagaacc gctgcctggc tccattctgg aaatgtggga tggtgagatc
      421 taccactatg ggctgtatgt tgagcggggg catgtgctcg gagtacacaa accacctgct
      481 gcaataagcc ttgccaaaat tgaaataaca ccgctgtctc tctactggag agtggtctac
      541 actccccagt atttgataga tccaggaact cttaagaact tgagtggaga gactttccca
      601 tacacggcct ttgacaacaa ctgttatgcc ttctgttgtt gggtcctaga cctcaacgac
      661 tcctggctta gcaggagaat gatccaaaga acaactggat tcttcaaacc ttatcaggat
      721 tggaacagaa aacccttacc aaccatggat gaaacgaaaa tcaagaaggc cgcgaatgct
      781 gtcctatgtg ctctctcctc acttttcact agacccatta aggacatcat tggaaagctt
      841 agaccactga acattcttaa tatactggca acctgcgatt ggacttttgc aggcatagtg
      901 gaatccttga tccttcttgc tgaactcttt ggggtgttct ggacaccccc agatgtgtct
      961 gcgatgattg ctcccttact cggtgactac gagatgcaag gccccgaaga cctggccgtg
     1021 gaacttgtgc ccgtggtgat gggaggaata ggtttggtgt taggattcac caaagaaaag
     1081 atcggcaaga tgctttcatc agctgcgacc acacttaggg cctgcaagga tctaggatct
     1141 tatggattgg agatactcaa attggtcatg aagtggttct tccccaagaa ggaggaggct
     1201 aacgaactag ccatggtgag ggccattgag gatgcagtcc tggatttgga ggcaatagaa
     1261 aacaatcaca tgaccaccct tctcaaggat aaagacagcc tggccacata catgaggact
     1321 cttgacttgg aggaagagaa agcaaggaaa ctgtcaacca aatcggcgtc acctgacatc
     1381 gtgggcacaa taaacgcatt attggctagg atagcagccg ccaggtcact ggtccacaag
     1441 gctaaggagg agctctcgag cagacagaga cctgttgttg taatgatatc aggtagacca
     1501 ggtataggaa agacccatct ggccagagag ctagccaaga aagttgcgtc aacactgtca
     1561 ggcgaccaaa ggattggact ggtgcctaga aatggcgtcg accattggga cgcctacaag
     1621 ggagaaaggg tggttctgtg ggatgattat ggtatgagca accctataca ggacgcactg
     1681 aggctccaag aattggctga cacctgtcct ctgaccctaa attgtgatag gattgaaaac
     1741 aaaggaaaag tgttcgacag tgatgccata attataacaa ccaaccttgc aaacccagca
     1801 ccactagact atgtcaactt tgaggcctgc tctagacgca tagacttctt ggtgtatgca
     1861 gacgcacctg acattgagaa ggctaagcgt gacttccctg gccaaccaga catgtggaaa
     1921 gaccatttca gaccagactt ctcacacatt aaacttcagc tggcaccaca gggaggtttt
     1981 gacaaaaatg gcaacacccc acatggcaaa ggtgtggtga agtccctgac gattggttct
     2041 ctgatcgcca gggcctccgg cttgctccac gagagaatgg atgaattcga gctccaaggc
     2101 tctgacctgc caaccttcaa ttttgaccgc aacaaagtcg ccgccttcag acaattggca
     2161 gctgaaaaca aatatggtct tatggacaca ctgagggtcg gcaaccaact gaaaagtgtt
     2221 aagaccctgg atgagctgaa gcaggccata aagaacatca gtatcaagaa gtgtcagata
     2281 gtgtataatg gatgcaccta taccatggaa tctgatggga ggggcaaggt tgtggttgaa
     2341 aaggtacaaa acgcaacagt tcaaaccaac aatgaacttg taggggcgct ccaccacctg
     2401 agatctgcaa ggataagata ctatgttaaa tgtttccaag aagccattta ctctctactc
     2461 caaattgctg gtgcagcctt cgtcacctca cgcatcgtga ggcgcatgaa catatcaaac
     2521 ctctggtcga agccacccat cgaggagggt gatgggcctg aagacagagg aggatgcccc
     2581 aagcccaggg atgaagatga cctcactatt gactctagag acattaaagt ggaagggaag
     2641 aagggcaaga acaagtctgg ccggggcaag aaacacacag ccttctcttc caagggcctc
     2701 agtgatgaag agtacgatga gtacaagaga atcagagagg agaggaatgg caaatactca
     2761 atagaggaat acctccaaga tagggacaga tactatgaag agcttgccat tgctaaggcc
     2821 actgaggagg acttctgtga ggaggaggag atcaaaatcc gccagagaat cttccgaccc
     2881 accaggaagc agcggaaaga ggaaagggcc acgcttgggc ttgttacagg atcggaaatc
     2941 agaaagagga atccagatga ctttaaacca aaaggaaaat tgtgggctga tgacaacagg
     3001 agcgtggatt acaatgagag gatagatttt gaggctcccc cgagtgtttg gtctaggata
     3061 gtcaactttg gcacaggctg gggattctgg gtttctccaa gtctctttat aacttcaaca
     3121 cacgtcatac caaaaggaat cactgaggcc tttggagtgc ccataaacca aatccaaatt
     3181 cacaaatctg gagaattttg ccgcttgcgg tttccaaagc caattagacc agacgtgagt
     3241 gggatgatct tggaagaggg cgcccctgaa ggcactgttg tgtctattct catcaaaagg
     3301 acaacagggg agctgatgcc tcttgcagtc agaatgggga ctcatgccac attgaaaatc
     3361 caaggtagaa cggtgggtgg tcagatgggt atgcttctca ctggctcaaa tgctaaaagc
     3421 atggatctag gcacaacgcc aggtgactgc ggatgtccat acatgtacaa aaggggcaat
     3481 gaccttgtgg tcattggggt gcacactgca gcagctcgtg gaggcaacac ggtcatatgt
     3541 gccacacagg gaagtgaagg tgaagccact cttgaaggag gtgacaacaa gggtacctat
     3601 tgtggagccc ccattttggg acccggcaat gcaccaaaat tgagcacaaa gacaaaattc
     3661 tggagatcct ctaacgcacc gcttccacca ggtacttatg aaccagcata ccttggtggg
     3721 agagacccgc gtgtgaaggg aggcccatct ctgcaacaag ttatgagaga ccaacttaag
     3781 ccttttacag agcccagagg gaagccacca aacccaaatg tcttagagtc agcaaagaag
     3841 actatcatca atgttctgga acaaaccatt gacccccctc aaaagtggtc atatgcccaa
     3901 gcttgtgcat ccctcgacaa gacaacctcc agtggatacc cgcaccacgt ccggaagaat
     3961 gactattgga gtggtgaatc cttcacagga aaacttgcag atcaggcttc aaaagcaaat
     4021 ctcatgtatg aggaaggcaa gcacatgcaa ccagtttaca ccgcagcact caaagacgag
     4081 ctcgtgaaaa ctgacaaaat ttatggcaaa atcaagaaaa gactcctgtg gggttctgac
     4141 ctctccacaa tgattcgatg cgccagagca tttggtggtc tcatggatga attcaaagca
     4201 aattgtatta cactccctat cagagttggt atgaatatga atgaagatgg tcccataata
     4261 tttgagaaac actccaggta caggtaccac tatgatgctg attactcccg ctgggactcc
     4321 acacaacagc gggcagtgct ggaagcggca cttgaaatca tggtgagatt ttctgctgag
     4381 ccacagctgg cacaaatagt ggcagaggac ctgctgtcac caagtgtggt tgatgtgggc
     4441 gatttcaaaa tcgctatcaa tgaaggccta ccatctggcg tgccttgcac ctcacaatgg
     4501 aattctattg cccactggtt acttaccttg tgtgcccttt ctgaagtgac aggattaggt
     4561 cctgacatca tacaagctaa ctccatgtac tctttctatg gtgatgatga gattgtgagc
     4621 acagacataa aattggaccc agagaaattg accgcaaagc tcaaagaata tggccttaaa
     4681 cccactcggc ccgacaaaac tgaggggccg ttggtgatta gtgaggatct gaatgggttg
     4741 actttcctcc gccgaacagt cacccgtgat ccagcaggtt ggtttggaaa gttggaccaa
     4801 aactccatcc tcaggcagtt gtactggaca agaggaccca accatgaaga ccccagtgag
     4861 accatgatac cacacgcaca aagacctgtg cagctcatgg cactactagg agaatcctcc
     4921 ctacatggac cctcatttta cagcaaggtt agcaaattag tcatatctga acttaaagag
     4981 ggaggaatgg atttttatgt gcccagacaa gagtcaatgt tcagatggat gaggttctca
     5041 gatctaagca catgggaggg cgatcgcaat ctggctccca gttttgtgaa tgaagatggc
     5101 gtcgaatgac gccgctccat ctaatgatgg tgctgctggt ctcgtaccag agggcaacaa
     5161 cgagaccctt cccctagaac cagttgcggg cgcagctata gccgcacccg tcactggcca
     5221 aaataacata attgacccct ggattagaac aaattttgtg caagcaccaa atggagagtt
     5281 cacagtgtca cccagaaact ctcctggaga aattttatta aacttagagt tgggccctga
     5341 tttgaaccct tatttggctc atttgtcaag gatgtacaat gggtatgctg gtggagtgga
     5401 agttcaggtt ctcctggcag ggaacgcgtt cactgccgga aagatcctat tcgccgccgt
     5461 cccgccaaat ttcccagtgg aattcttaag cccagcccag atcacaatgc tcccacattt
     5521 aatagtagat gttaggactc ttgaaccaat tatgatccca ctccctgatg ttaggaatac
     5581 attcttccat tatagtaacc agcctaacag ccgcatgaga ttagtggcta tgctctatac
     5641 cccactcaga tctaatggct caggtgatga tgtctttact gtctcttgta gggttttgac
     5701 taggcctact cctgattttg agttcactta tttagtgcca ccttctgttg aatctaaaac
     5761 taagcctttt tccttaccta ttttaaccct ttctgagctc acaaattcga ggttcccagt
     5821 ccccatcgat tcgcttttca ccgcccagaa taatgtgttg caggtgcagt gtcaaaatgg
     5881 caggtgtaca cttgatggtg agttacaagg cacaacccag ttgctcccat ctggcatctg
     5941 tgcattcaga ggacgggtga cagcacaaat taaccaacgt gacaggtggc acatgcaact
     6001 gcaaaacctt aatggtacaa catatgaccc aactgatgat gtgccagccc cgctgggtac
     6061 acctgacttc aagggcgtcg tgtttgggat ggtaagccaa agaaatgtgg gtagtgatgc
     6121 gcctggctca accagagccc aacaggcgtg ggtttcaacc tatagccccc aatttgtccc
     6181 caaattaggt tctgtcaatc ttagaattag tgataatgat gatttccaat tccagccgac
     6241 aaaattcaca ccagtgggcg tcaatgatga cgatgatggc cacccgttca gacaatggga
     6301 actaccaaac tattcagggg agcttacctt gaatatgaat cttgcccccc cagttgctcc
     6361 aaattttcct ggtgagcaat tgttattctt cagatctttc gtgccatgct caggaggtta
     6421 caaccaaggt attatagatt gtcttattcc ccaagaatgg atccaacact tctatcagga
     6481 atcagcaccc tcccagtcag acgtggccct aatcaggtat gtcaaccccg atacgggacg
     6541 tacactgttt gaagcaaaat tgcacagatc tggttacatt actgtggccc actctggaga
     6601 ctatcctctt gttgttccgg ctaatggaca ctttagattt gattcttggg taaatcagtt
     6661 ttactcactc gccccaatgg gaactgggaa tgggcgtagg agggctcagt aatggctggg
     6721 gctttcattg caggattggc aggcgacatg ctcacgtcat ctgtgggctc ccttgtgaac
     6781 gcaggggcaa acgccatcaa ccaaaagata gactttgaaa acaacaaaca actccagtct
     6841 gcttcctttc agcatgataa agagatgctc caagcgcagg tgagggcaac caagcagctg
     6901 caatctgaaa tgatagccct aaaacagggg gttttggccg caggcggctt ttcccccact
     6961 gatgcagcaa ggggatccat tggtgcaccc atgacaaagg tgcttgactg gtctggcact
     7021 cgatactggg cgcccaattc cacaaagaca actggctatt cgggacaatt cacctcttca
     7081 cctgtgcata tgtctagccc aaatgctcca caatcaaaac ctgcaaagcc taggtctcta
     7141 gctccttcct cttcttctag cagtgtctat agtatgtata ctcaatctac tcatttaaca
     7201 tctggctctt ctagtaatgc ttcttctgcc tccacaaaat tgacaaattt aagctctggc
     7261 tcctctcaaa acagaacagc agagtgggta aatcaacaga ggagtcttag ccctttcatg
     7321 agtggcgcac ttaacatctc acatgtcacg ccaccctcaa gtagggcttc cagttctggg
     7381 acggtctcga ccgtgcccaa ggaagttttg gactcctgga cgtctgcgtt taacacacac
     7441 agacagccgc tcttcgcaca cctcagagtg aggggggagt cacgtgttta gtgaaaagaa
     7501 ataattggct ataatgtgat ttctttctaa
//