Typing tool

Complete norovirus genomes

MF405169  GII.2
 GII.P32

Length: 7,536 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       MF405169                7536 bp    RNA     linear   VRL 14-AUG-2017
DEFINITION  Norovirus GII.2 strain Hu/US/1971/GII.Pf__GII.2/HenrytonSP17,
            complete genome.
ACCESSION   MF405169
VERSION     MF405169.1
KEYWORDS    .
SOURCE      Norovirus GII.2
  ORGANISM  Norovirus GII.2
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Karangwa,C.K., Parra,G.I., Bok,K., Johnson,J.A., Levenson,E.A. and
            Green,K.Y.
  TITLE     Sequential Norovirus Gastroenteritis Outbreaks in a State Hospital
            within a Single Year and the Absence of Herd Immunity
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Karangwa,C.K., Parra,G.I., Bok,K., Johnson,J.A., Levenson,E.A. and
            Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUN-2017) LID/NIAID, NIH, 50 South Drive-MSC8026,
            Bethesda, MD 20892, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Bowtie v. v. 2; Sequencher v. v.5
            Assembly Name         :: Henryton GII.2
            Sequencing Technology :: IonTorrent; Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus GII.2"
                     /mol_type="genomic RNA"
                     /strain="Hu/US/1971/GII.Pf__GII.2/HenrytonSP17"
                     /host="Homo sapiens"
                     /db_xref="taxon:490039"
                     /country="USA"
                     /collection_date="Jan-1971"
                     /note="genotype: GII.2"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ASO96883.1"
                     /translation="MKMASTDASAAAAANSNNDNVKSSNDGVFNNMAVTLKRALGARP
                     KQPTPREKPPKPPRPPTPELIKRIPSPPPNGEDEPIVSFSATGGVSGLPELTTVGQPP
                     EANTAFSVPPLSLRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     VAKVELTPLSLYWRPVYTPHYLISPDNLKKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLARDL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRNDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLVARA
                     SGLLHERMDEYELQGPSLSTFNFDRNKIAAFRQLAAENKYGLMDTMRVGNQLRNVTTM
                     AELKQALRNITIKKCQLVYGGSTYTLESDGKGKVMVEKVQNTSIQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSVLQIAGTVFVTSRIVSRMNIQNLWSRPQIEDTDVTTADEGC
                     PKPRDEEEFVISSDDIKSEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEIKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQIQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLDAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGFPHHVRKNEHW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKSHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQVVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPGKLTEKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGRLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /note="180 copies of this approximately 60 kDa protein
                     forms the viral capsid"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="ASO96884.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMFTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNEHLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     VISQRDNHNASGHNQPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDVEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYLPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7492
                     /gene="ORF3"
     CDS             6713..7492
                     /gene="ORF3"
                     /codon_start=1
                     /product="minor capsid protein VP2"
                     /protein_id="ASO96885.1"
                     /translation="MAGAFIAGLAGDVLSNGLGSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQVQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGRFTSTAPTRQADLQHAQNRPSSGSSVSSYSTQSSRPTLTTTV
                     GSSHSAVPSNSTRSTNLSMSTVSRATSRTSEWVRDQNKNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta ccgacgcttc tgctgccgct gctgctaaca gcaacaacga
       61 caacgtaaaa tcttcaaatg acggagtgtt taacaacatg gccgtcactc ttaaacgagc
      121 cctcggggct cggcctaaac aaccaacccc gagggaaaaa cccccaaaac cccccagacc
      181 accaacacca gaattgataa agagaatccc ctccccccca cccaatggcg aggatgagcc
      241 aattgtgtca tttagtgcca cgggtggcgt gtctgggttg cccgagctca caactgtcgg
      301 gcagccgcct gaggccaaca cggccttcag tgtgcccccg cttagcctaa gggagaatag
      361 ggatgccaaa gaacccctaa ccgggaccat tttggaaatg tgggatgggg agatttatca
      421 ttatggtctg tatgtggagc gaggccttgt gttgggtgta cataaaccac cagcagccat
      481 cagtgtagcc aaagtggagc tgactcccct ttcactgtac tggaggcctg tatacacgcc
      541 ccattatctc atctccccag acaacctgaa gaaacttcat ggggagttat ttccctacac
      601 ggcgttcgag aacaactgct acgccttctg ctgctgggtt ttggacttga acgattcgtg
      661 gttgagcagg aggatgatta gcaggaccac aggcttcttc agaccttacc aagaatggaa
      721 caggaagccc ctcccaacca tggacgattc aaaactgaaa aaggttgcaa acatcgtcct
      781 gtgtgccttg tcatcgctat ttactaggcc catcaaagat ataatcggaa agcttagacc
      841 cctgaatatc ctaaatatct tagcttcatg tgattggact tttgctggca tagtggaatc
      901 tctaattctt ttagcagaac tctttggtgt attctggacg cccccagacg tgtctgcgat
      961 gatcgcaccc ctactcggcg attacgagtt gcagggccca gaggaccttg ctgtggagct
     1021 cgtgccggtc gtaatgggcg ggataggctt ggtgctgggg ttcaccaagg agaaaatagg
     1081 caaaatgctc tcctctgctg cttcaacctt aagagcctgc aaagatcttg gagcctatgg
     1141 actagagata ctgaaactgg tcatgaaatg gttctttcca aagaaagacg aggccaatga
     1201 gttagctatg gtaagagcca ttgaagacgc agtactggac ctagaagcca ttgagaataa
     1261 ccatatgacc actctgctca aagataagaa cagtcttgca gcctacatga agaccttaga
     1321 tatggaagaa gagaaggcaa ggaaactgtc cacaaagtca gcttcccctg acatcgtggg
     1381 cacaatcaat gctttgcttg cacgaatcgc tgccgcacgc tcattagtcc atagagctaa
     1441 ggaagagctc tccagcagac cgagaccagt cgtggttatg atttctggca aacctggaat
     1501 aggaaaaaca cacttggcta gggatttggc aaagaagata gcctcgaccc tcacaggaga
     1561 tcaaagagtg gggcttatcc cgcgcaatgg ggtcgatcat tgggacgctt ataaaggtga
     1621 aagggtcgtg ctatgggacg actatggtat gagcaacccc atccatgatg ctctcagact
     1681 acaagagctg gcagacacat gccccttaac tttgaactgt gacagaattg agaacaaggg
     1741 aaaagtcttt gacagtgatg caatcatcat caccaccaat ttggtcaacc cggcaccact
     1801 agactatgtt aactttgagg cctgctccag gcgcattgac ttcctcgtgt atgctgatgc
     1861 tcctgaggtt gagaaggcga aacgggactt ccccggccaa ccagacatgt ggaaagatgc
     1921 ctatcgcaat gacttctcac atatcaaact gcaactggca ccacagggtg gatttgacaa
     1981 gaacggtaac accccccacg gcaaaggtgt gatgaaaacc ctgaccactg gatcgcttgt
     2041 tgcgcgcgcc tcaggccttt tgcacgagag aatggatgag tacgaactgc aaggaccatc
     2101 cctctcaacc ttcaacttcg accgcaacaa aatcgcggca ttcaggcagc tcgccgctga
     2161 aaacaagtat ggtttgatgg acacaatgag ggtgggcaac cagttgagga atgttacaac
     2221 tatggctgag ctgaagcagg ccttgaggaa catcacgatc aaaaagtgtc agttagtcta
     2281 tggtgggagc acttacactc tcgagtctga tggcaaaggt aaagttatgg ttgaaaaagt
     2341 gcaaaacact agcatacaaa tcaacaatga aattgctggg gcagttcacc atctcagatg
     2401 tgccagaata agatactatg tgaagtgtgt ccaggaggcc atttactcag tactccaaat
     2461 tgccggcaca gtgtttgtta catcacgcat tgtgagccgc atgaacatcc aaaacctatg
     2521 gtctaggcca cagatagagg acacagatgt gaccaccgca gatgaagggt gtcctaaacc
     2581 tagggatgag gaagagtttg ttatctcttc agatgatatc aagtcagaag ggaaaaaggg
     2641 caaaaacaag agtggccggg gcaagaaaca cacagcattc tcaagcaaag gcctcagtga
     2701 cgaggagtat gaggagtata agaggatcag agaggagagg aatggcaagt actccataga
     2761 agagtatctt caagacagag ataaatacta tgaggaggtg gccattgcaa gagcaactga
     2821 agaagacttt tgtgaagaag aggagatcaa aatccgccaa aggatcttca ggcctactcg
     2881 gaaacaacgt aaagaagaga gagccaacct cggcctcgtc actggatctg agatcaggaa
     2941 aagaaaccca gatgacttca aaccaaaagg gaaactgtgg gctgatgacg accgaagtgt
     3001 cgactacaat gaaaggatta gttttgaggc cccacctagc atctggtcca ggatcgtgaa
     3061 ctttggttct ggatggggat tctgggtctc acccagtctc ttcataacat caacacatgt
     3121 tatacctcaa ggcataaccg aagcttttgg agtgcccata agacagatcc aaatacataa
     3181 atcaggtgag ttctgtcgcc tgagattccc aaaacccatc agaacagatg tttcaggaat
     3241 gattctggag gagggagcac cggagggcac cgttgctacc atcttgatta aaagaaccac
     3301 tggagagttg atgcccctcg cagcacggat gggcacacat gcgactatga aaatccaagg
     3361 tcgcacggtg ggtggacaga tggggatgct gcttactggg tccaacgcca agagcatgga
     3421 tcttggcacc acacctggtg actgtgggtg cccctacatc tacaagaggg gaaacgacta
     3481 tgtggttatt ggtgtccata cagctgctgc ccgtgggggg aacactgtca tctgtgccac
     3541 acaagggagt gaaggtgagg caacacttga aggtggcgac aacaagggaa catattgtgg
     3601 agcgccaatt ctcggccctg gaagcgctcc aaagctaagc accaaaacca agttctggag
     3661 gtcttccacg acaccgctcc cacctgggac gtatgagcca gcatacttgg gaggaaagga
     3721 cccccgagtt aaaggtgggc catctctaca acaagtcatg agggatcaac tgaaaccatt
     3781 cactgagcct cgtggcaagc ctccaagacc cagtgtcctt gatgcagcca agaaaactat
     3841 catcaatgtg ctagagcaaa caatagatcc cccgcaaaag tggacgtacg ctcaagcgtg
     3901 tgcgtcactt gacaaaacca cctccagcgg gttcccccac catgtacgta aaaacgaaca
     3961 ttggaacggg gagactttca ccggaaaatt ggctgaccag gcctcaaaag caaaccttat
     4021 gtttgaggag gggaaacaca tgactccagt ttacacagct gcccttaaag atgaattagt
     4081 gaagaccgac aaagtgtatg ggaagatcaa aaagagacta ctttggggtt cggatctggc
     4141 cacaatggtg cggtgtgcgc ggtcctttgg gggcctgatg gatgagttaa aatcacactg
     4201 cgtaaccctc cccatcaggg ttggcatgaa catgaatgag gacgggccca tagtctttga
     4261 gaaacactcc aggtacaggt atcattatga tgcagactac tccaggtggg attcaacaca
     4321 acagagggct gtactggctg cagccatgga aattatggta aagttttcag cagaaccaca
     4381 gttagcccag gtagttgcag aagatttgct gtctcctagt gtggttgacg tgggcgactt
     4441 taaaatttca atcaatgaag gcctaccgtc aggtgtgccg tgcacatccc agtggaattc
     4501 catcgcacat tggttactca ccctttgtgc cctctctgaa gtcacagact tgtctcctga
     4561 catagtgcag gccaactccc tcttctcctt ctatggtgat gatgaaattg tgagcacaga
     4621 cataaaattg gacccaggca aactaacaga gaagctgaaa gaatatggtc ttaagcccac
     4681 ccgccctgac aagactgagg ggcctttaat tataagtgaa gacctgaatg gcctaacgtt
     4741 cctgcggagg acagtcaccc gtgatcctgc aggatggttt ggaagattgg accagagctc
     4801 tatactaagg caattgtact ggaccaaagg tcccaaccat gaagaccctt ttgagtcaat
     4861 gatcccacac tcccaaaggc ccatacagct catgtcactc ctaggtgaag cagcattgca
     4921 tgaaccctca ttctacagca agatcagcaa gttggtgata tctgaattga aggaaggtgg
     4981 aatggatttt tacgtgccca gacaggaacc aatgttcagg tggatgagat tctcggattt
     5041 gagcacgtgg gagggcgatc gcaatcttgc tcccagtctt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aataatgagg
     5161 tcatggctct tgaacctgta gctggtgccg ccttggcagc tccagttact ggccaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccccaatggt gaattcaccg
     5281 tttccccgcg caatgcccct ggtgaagtgc tattaaatct agaattgggt ccagaattaa
     5341 atccttatct ggcacacttg gcaaggatgt acaacggcta tgctggtggc atggaggtgc
     5401 aggtcatgct agctggaaat gcgtttacag ctggtaaatt ggtcttcgcc gctgtgccac
     5461 ctcatttccc agttgagaat ctgagcccgc agcaaatcac catgttccct catgtgatta
     5521 tagatgttag aactttggaa cctgttttat tgccactccc tgatgttaga aataactttt
     5581 tccattataa ccagaaagat gaccccaaaa tgaggattgt ggccatgctt tatactcccc
     5641 tcaggtcgaa tggctctggt gatgatgtgt ttacagtttc ttgcagggtg ttaaccaggc
     5701 cctcccctga ctttgacttt acatacctgg taccaccaac agtagagtct aaaacaaaac
     5761 catttactct cccaatcctc acacttggtg agttatccaa ttccagattt cctgtgtcca
     5821 tagatcaaat gttcactagc cccaacgagg tcatatcagt gcagtgtcag aatgggagat
     5881 gtacgctgga tggggagctc caaggaacaa cacagctcca ggttagcggt atctgtgcat
     5941 tcaagggaga ggtgactgct cacttgcacg ataatgaaca cctttataac atcaccatca
     6001 caaatttaaa tggatcccct tttgaccctt ctgaggacat tcctgcccca ctgggtgtac
     6061 cagactttca agggagagtt tttggtgtca tcagccaaag agacaaccac aatgccagtg
     6121 gacataacca gcctgcaaac aggggccatg atgccgtggt tcccacatac acagcccaat
     6181 acaccccaaa gttaggccag atccaaattg gcacgtggca gactgatgac ctaacagtca
     6241 atcagcctgt caaattcacc ccagttggcc ttaatgatgt ggagcatttc aatcaatggg
     6301 tggtccccag gtatgctggt gccctaaacc taaacacaaa tcttgcccct tctgttgcac
     6361 cggtgtttcc aggggaacga ctgctcttct tcagatcata cctccccctc aagggtggtt
     6421 atggcaaccc agccattgac tgcctgttac cacaagaatg ggtgcagcac ttctaccaag
     6481 aggccgcccc ttcaatgagt gaggtggccc ttgttagata cattaaccca gacaccggtc
     6541 gggcgctgtt tgaggccaag cttcacagag ctggtttcat gacagtctcg agcaacacca
     6601 gtgccccagt agttgtacct gccaatgggt atttcagatt tgactcttgg gtgaaccaat
     6661 tttattcttt agcccccatg ggaactggga atgggcgtag aagagttcaa taatggctgg
     6721 agcttttata gctggtcttg caggagacgt gctcagtaat gggctcggct cattgattaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaatcaga aattgcaaca
     6841 aaattctttt aatcatgata aggaaatgtt acaggctcaa gttcaagcaa ctaagcagct
     6901 gcaagcagac atgatggcta taaagcaagg ggtcttgacc gctggcggct tctcccctgc
     6961 tgatgcagcc agaggcgcag ttaacgcgcc catgacacaa gcgctggact ggaatggtac
     7021 aaggtattgg gcaccaggtt ccatgaggac aacatcttac tctggaaggt tcacatcgac
     7081 tgctccaaca aggcaggccg acttgcagca tgctcaaaac cgaccgtcga gtggttcttc
     7141 tgtgtcctcc tattccactc aatcttcaag accaaccctg actacaacag tggggtcttc
     7201 acacagtgca gtcccatcca attcgactcg gagcacaaat ctctctatgt ccactgtttc
     7261 tagagccact tctagaacca gtgaatgggt cagggatcaa aataaaaatt tggaacccta
     7321 tatgcatggt gccttacaga cagcttttgt cacaccacca tccagcaggg catccgacgg
     7381 gacggtctca accgttccca agggtgtttt ggactcctgg acacctgcgt ttaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagcat agtgaaaagg
     7501 taaaatctag cttaaaatga attgatctta tctttt
//