Typing tool

Complete norovirus genomes

MF167652  GII.2
 GII.P16

Length: 7,502 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6709
ORF3: 6709..7488
LOCUS       MF167652                7502 bp    RNA     linear   VRL 30-SEP-2017
DEFINITION  Norovirus Hu/JSWX201703-10/CHN non-structural polyprotein, capsid
            protein, and minor structural protein genes, complete cds.
ACCESSION   MF167652
VERSION     MF167652.1
KEYWORDS    .
SOURCE      Norovirus Hu/JSWX201703-10/CHN
  ORGANISM  Norovirus Hu/JSWX201703-10/CHN
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7502)
  AUTHORS   Fu,J.-G. and Ai,J.
  TITLE     Norovirus outbreak sequence in Jiangsu, China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7502)
  AUTHORS   Fu,J.-G. and Ai,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-MAY-2017) Department of Acute Infectious Disease
            Control and Prevention, Jiangsu Provincial Centre for Disease
            Control and Prevention, Jiangsu Rd, 172, Nanjing, Jiangsu 210009,
            China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7502
                     /organism="Norovirus Hu/JSWX201703-10/CHN"
                     /mol_type="genomic RNA"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:2029702"
                     /country="China"
                     /collection_date="20-Mar-2017"
     CDS             1..5100
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ASV60381.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAVLEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDGEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     CDS             5081..6709
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ASV60382.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEIISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6709..7488
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="ASV60383.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaag
       61 gaaaaatctt caggtgaagg cttattcaca aatatgtctt ccaccttaaa gaaagccctc
      121 ggggctaggc ccaaacagcc tgccccgaga gacaaaccac aaaagccccc aagaccacca
      181 actcccgagt tggtcaagag gataccccct cctccaccta atggcgaaga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg atctctggcc tgcccgagct cacaacagtc
      301 ccccaaccgg acgtggccaa cacagcattc agtgttccac cactgagctt gagagaaaac
      361 agggaggcca aggagccgct aacaggggca gtattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtacgtgga gaaaggctta gtgttgggtg tgcacaaacc acctgcagcc
      481 ataagcatgg caagagtgga gctgacgccg ttgtcattgt actggcgtgt ggtatacact
      541 ccccaatacc tcatctcccc tgaaaccctc aggaggctca acggagaggc attcccttac
      601 accgcctttg acaacaactg ctatgccttt tgctgctggg tgttagacct caatgactca
      661 tggcttagca ggaggatggt acaaagaaca acgggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcctac catggatgac tccaaaatta agaaggtagc aaatatattc
      781 ctatgttcat tgtccacatt attcaccaga cccataaaag acctcatagg aaaaattaaa
      841 ccattgaaca tattgaatat cctggcaacg tgtgactgga cttttgccgg aatagtggag
      901 tctctgatat tacttgctga actcttcgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttactcgg ggactacgag ttgcaagggc cagaagacct cgccgttgaa
     1021 ctcgtacctg tggtaatggg ggggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaaca ctcagggctt gcaaagatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga ggaggccaat
     1201 gagctagcta tggtgagggc catagaggat gctgtactag accttgaggc aatagaaaat
     1261 aaccacatga caaccctgtt gaaagacaaa gacagcttag caacatacat gaaaacactg
     1321 gacatggagg aggagaaagc caggaggttg tccacaaaat ctgcatcccc tgacatagtt
     1381 gggacaatca acgccctgct ggctcgaata gcagcggcca ggtcattagt ccacagggcc
     1441 aaagaagagc tatctagcag gataaggcca gtagttgtta tgatatctgg caaaccagga
     1501 ataggcaaaa ctcatctggc cagggaggtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcggactcat accacgaaac ggtgtggacc attgggatgc atacaaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagtaacc ccattcatga tgctcttcgc
     1681 atacaagaat tggctgatac gtgtcccctt accttaaatt gtgacagaat cgaaaataag
     1741 ggaaaagttt ttgacagtga agtcataata attacaacaa accttgccaa tccagcccca
     1801 cttgattatg tcaactttga ggcctgttcc aggaggattg atttcctggt gtacgctgag
     1861 gcaccagaag tagaaaaggc aaaacgggac tttcctggtc agccagatat gtggaaggac
     1921 gctttcaagc cggacttttc acacatcaag ctacagcttg caccccaagg cggctttgac
     1981 aagaatggca acaccccaca tgggaaagga gtgatgaaga ccctcactac cggttctctg
     2041 attgcccgtg catcaggcct actgcatgag aggatggatg aatttgaact ccaaggtccc
     2101 acaatcacca ccttcaattt cgaccggaac agaatcacgg cattcagaca attggctgca
     2161 gaaaacaagt atggattggt ggataccatg aaagttggca atcaattaaa aggagtgaaa
     2221 accatggaag aactcaaaca agcaatcagg aatgtgacca tcaagaggtg ccagatcatc
     2281 tacggtggtt ccacgtatga ccttgaatct gacggcaagg gcaaagtttt ggtggaaaag
     2341 gtcaagaaca cctctgtaca gaccaataac gagttggctg gggctctgca ccatctcaaa
     2401 catgcccgaa tcaggtacta tgtcaaatgt gtgcaagaag cagtctattc catcatacaa
     2461 attgccggcg ctgcgtttgt caccacgcgc attgcacgcc gcatgaacat acaagaactc
     2521 tggtcgaagc cacaactaga tcaaaatgaa tcagagacta aggaagaggc ccccaagtca
     2581 gaagatggcg agttcattat atcttctaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aacaaaactg gccgtggcaa gaaacacact gcattctcca gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaatg ggaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gagctcgcca ttgccaaggc cacggaagaa
     2821 gacttctgtg aagaggagga gatcaaaatc cgtcagagaa ttttccgtcc caccaggaaa
     2881 caaagaaagg aagagagggc cacattaggg ctagtaacag gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc caaagggaag ctgtgggccg atgacaacag gagtgttgac
     3001 tacaatgaga aactggactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggttctggct ggggcttctg ggtgtcacca agccttttca taacatcaac tcatgtaatc
     3121 cccgcaggca taacagaagc atttggagtc cccatcaaac aaattcagat ccacaaatca
     3181 ggcgaatttt gccgattcag attcccaaaa ccaattagac cagatgtgac aggaatgatc
     3241 ttggaagaag gtgcgcctga gggcaccgtg gcaactgtgc tcatcaaacg ccccaccgga
     3301 gagctcatgc ctcttgcagc cagaatggga acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacagatggg tatgttgctc actggatcaa atgctaaagg gatggacttg
     3421 ggaacaactc ctggtgattg tggctgtcct tacatctata aaaggggcaa tgactatata
     3481 gtcattgggg tgcacactgc agcagcccgt ggtggaaaca ctgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccattctag gccctggggg tgcaccaaaa ttgagcacca aaaccaaatt ttggagatca
     3661 tcgaacacgc cccttccacc agggacatat gagcctgcct acctcggtgg ccgcgatccg
     3721 cgtgttaagg gtgggccttc cctgcagcag gtaatgagag accagttgaa gccattcact
     3781 gaacccaggg gcaaacctcc aagaccaagt gtattggaag cagccaaaca aaccatcatc
     3841 aatgtcctcg aacaaaccct ggaccctcca caaaaatgga catacgcaca ggcgtgtgcc
     3901 tcacttgaca aaaccacctc cagcgggcac ccccatcacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg taaactggca gaccaagcat caaaagcaaa cctaatgttt
     4021 gaggaaggga aacacatgac accagtgtac acagcagcac tcaaggacga gctagtcaag
     4081 actgagaaaa tctatggaaa gatcaagaag agactgctct ggggctctga cttgtccacc
     4141 atgatccggt gcgctaggtc atttggtggg cttatggacg agatgaaggc acactgcata
     4201 tcactcccag tccgagttgg catgaatatg aatgaagatg gcccaataat atttgagaaa
     4261 cattccagat acaaatatca ctatgatgca gactactctc gttgggattc aacacaacag
     4321 agggcagtac tagcagcagc cttggaaatt atggtcagat tctctgcaga accacaattg
     4381 gcacaaatag tcgctgagga tctgctggcc cctagtgtag tagatgtagg agactttaaa
     4441 attacaataa atgaagggct cccttctggt gtgccatgca cttctcaatg gaactccatc
     4501 gcacactggc tgctaactct ctgtgccttg tctgaagtca ccaaactgtc ccctgatatc
     4561 atacaggcaa attccatgtt ctcattttac ggtgatgacg agattgtcag caccgacata
     4621 aaattggacc ctgaacagtt aaccgccaaa ttgaaggagt acggcctaaa accaacccgc
     4681 ccagacaaaa ccgagggacc cctgattatc agtgaagatt tgaacggtct cactttcctc
     4741 cgaaggacgg tgactcgtga cccagctggc tggtttggaa aactggacca aagctcaatt
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgaag accccaacga gacaatgata
     4861 ccccattctc aaagacccat acagctcatg gcactgcttg gtgaagcctc tcttcacgga
     4921 ccctctttct acagtaaaat cagtaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aatttcgtga atgaagatgg cgtcgaatga
     5101 cgccgctcca tctactgatg gtgcagccgg cctcgtgcca gaaagtaaca atgaggtcat
     5161 ggctcttgaa cccgtggctg gtgccgcctt ggcagccccg gtcaccggtc aaacaaatat
     5221 tatagaccct tggattagag caaattttgt ccaggccccc aatggtgaat ttacagtttc
     5281 tccccgaaat gcccctggtg aagtgctact gaatctagag ttgggtccag aattaaatcc
     5341 ttatctggca catttagcaa gaatgtacaa tgggtatgcc ggtgggatgg aggtgcaggt
     5401 catgttggct gggaacgcgt tcacagccgg caagttggtc ttcgccgccg tgccacccca
     5461 cttcccggtt gaaaacctta gcccacagca aatcaccatg ttccctcatg tgatcataga
     5521 tgtgagaacc ctggaacctg ttttattacc actccctgat gttaggaata acttcttcca
     5581 ttataaccag aaagatgatc ccaagatgag aattgtggct atgctttata cccccctcag
     5641 gtctaatggt tcaggtgatg atgtgtttac agtctcctgt agagtgttga ctagaccttc
     5701 ccctgacttt gacttcacat acctggtgcc accaacagtg gagtctaaaa caaagccatt
     5761 caccctccca atcctcacac ttggggaact ttccaattct aggttcccag tgtccataga
     5821 ccagatgtac accagcccta atgaaattat atcagtgcag tgtcaaaatg gtaggtgcac
     5881 actggacggg gagctccaag ggacaacaca actccaagtc agtggcattt gtgctttcaa
     5941 aggtgaagtg accgcccact tgcatgacaa tgatcaccta tataatgtca ccatcacaaa
     6001 cttgaatggg tccccttttg atccctccga ggatatccct gcccctctgg gtgtgcctga
     6061 cttccaggga agggtttttg gtatcatctc ccaaagagat aaacacaata gtcctgggca
     6121 taatgaacca gcaaacaggg gacacgacgc tgtggtccct acttacacag cacagtacac
     6181 tccaaaactt ggacaaattc aaattggcac atggcaaact gacgacctta cagtcaacca
     6241 accagtcaaa ttcaccccag ttggactcaa tgacactgaa cactttaacc aatgggtggt
     6301 ccctaggtat gctggtgccc taaacctcaa tacaaacctt gccccttctg ttgctccagt
     6361 atttccagga gagcgcctgc tcttcttcag atcatacatt cccctcaagg gcggttatgg
     6421 aaacccagcc attgattgcc tactaccaca agagtgggtg caacacttct atcaggaagc
     6481 agccccttca atgagtgagg tggccctcgt cagatacatc aacccggaca ctggtcgggc
     6541 actgtttgag gccaagctcc acagagctgg tttcatgaca gtctcgagca acaccagtgc
     6601 cccggtggtt gtgcctgcca acgggtactt cagatttgat tcttgggtga accaatttta
     6661 ttctctcgcc cccatgggaa ctgggaatgg gcgtagaagg gttcaataat ggctggagct
     6721 tttgtagctg gtcttgcagg ggacgtgctc agcaatgggc ttagttcatt aatcaatgca
     6781 ggtgctaatg caataaatca gagggcagaa tttgatttta atcagaaatt gcagcaaaat
     6841 tcttttaatc atgataagga gatgttgcag gctcagattc aggcaactaa gcagctgcag
     6901 gcagacatga tggctataaa acaaggggtc ttgaccgctg gcggcttttc ccctgctgat
     6961 gcagccagag gtgctgtgaa cgcgcccatg acacaggcgc tggattggaa tggcacaagg
     7021 tattgggcac caaactccat gaggaccaca tcttattctg gaaaattcac atcaaccgcc
     7081 ccagtgaggc aagctgactt ccagcacacc caaagccggc cttcgagtgg ctcctctgtg
     7141 tcttcctttg ccactcagtc ttcaaggcca actctgacta caaccactgg ttcctcacat
     7201 ggcacagcct catcaaattc aactcgcagc acaagcctct cccaatcaac ggtctccaga
     7261 gctacatcta ggactggtga gtgggttaga gatcaaaata gaaatttgga accctacatg
     7321 catggtgcct tacagacagc ctttgtcacc ccaccttcca gcagggcatc tgacgggaca
     7381 gtctcaaccg tccctaaagg tgttttggac tcctggacac ctgcgtttaa cacccgcaga
     7441 cagccgcttt ttgcacacct ccgtaagagg ggggagtcac aagtttagtg aaaaggtgaa
     7501 aa
//