Typing tool

Complete norovirus genomes

LN854570  GII.1
 GII.P33

Length: 7,516 | 3 CDS

ORF1: 5..5110
ORF2: 5091..6698
ORF3: 6698..7468
LOCUS       LN854570                7516 bp    RNA     linear   VRL 12-JUN-2015
DEFINITION  Norovirus GII/Hu/NL/2014/GII.2/Groningen, complete genome.
ACCESSION   LN854570
VERSION     LN854570.1
KEYWORDS    complete genome.
SOURCE      Norovirus GII/Hu/NL/2014/GII.2/Groningen
  ORGANISM  Norovirus GII/Hu/NL/2014/GII.2/Groningen
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Bavelaar,H., Rahamat-Langendoen,J., Niesters,H.G.M., Zoll,J. and
            Melchers,W.J.G.
  TITLE     Whole genome sequencing of faecal samples as a tool for the
            diagnosis and genetic characterization of norovirus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7516)
  AUTHORS   Zoll,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2015) Medical Microbiology, RADBOUDUMC, PO Box
            9101, 6500 HB Nijmegen, NETHERLANDS
FEATURES             Location/Qualifiers
     source          1..7516
                     /organism="Norovirus GII/Hu/NL/2014/GII.2/Groningen"
                     /mol_type="genomic RNA"
                     /strain="GII/Hu/NL/2014/GII.2/Groningen"
                     /host="Homo sapiens"
                     /db_xref="taxon:1665651"
                     /note="genotype:GII.2"
     gene            5..5110
                     /gene="POL"
     CDS             5..5110
                     /gene="POL"
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="CRL46972.1"
                     /translation="MKMASNDASAAAAATSNNDIAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREATQKQKPPRPPTPELIKKIPPPPPNGEDDIVVSYSAKDGVSGLPELSTVRQ
                     PGETNTAFSVPPLNQRENRDAKEPLPGSILEMWDGEIYHYGLYVERGLVLGVHKPPAA
                     VSLAKVELTPLSLYWRPVYTPQYLISPETLKKLHGETFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDII
                     GKLRPLNILNILASCDWTFAGVVESLILLAELFGVYWTPPDVSALIAPLLGDYELQGP
                     EDVAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLIMKWF
                     FPKKDQVNELAMVRSIEDAVLDLEAIENNHLTTLLKDKDSLATYMKTLDLEEEKARKL
                     STKSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAR
                     DLAKKVAATLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELAD
                     TCPLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDV
                     EKAKRDFPGQPDMWKDAFKSDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTSGSLVA
                     RASGLLHERLDEYELQGPTPTTFNFDQNKVFAFRQLAAENKYGLMDTMRVGSQLKNVK
                     TVSELKQALKNISIKRCQIVYSGLTYSLESDGKGNVRIEKVQSPAVQTNNELTGALHH
                     LRCARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRINIQNLWSRPQVEDEEETTSKD
                     GCPKPKDEEEFVISSEDIKAEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREER
                     NGKYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRVFRPTRKQRKEERASLG
                     LVTGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWV
                     SPSLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAP
                     EGTVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTP
                     GDCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEAVLEGGDNKGTYCGAPI
                     LGPGNAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFT
                     EPRGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTFAQACASLDKTTSSGYPHHVRKNE
                     YWNGESFTGKLADQASKANLMFEEGKHMTPVYTGALKDELVKTDKIYGKIKKRLLWGS
                     DLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYTYHYDADYSR
                     WDSTQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISITEGLPSGVP
                     CTSQWNSIAHWLLTLCALSEVTDLAPDIIQANSLFSFYGDDEIVSTDIKLDPERLTTK
                     LKEYGLKPTRPDKTEGPLIISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTR
                     GPNHEDPFETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVISELKEGGMDFYVPR
                     QEPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5091..6698
                     /gene="VP1"
     CDS             5091..6698
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="CRL46973.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRMNFVQAPNGEFTVSPRNSPGEVLLELELGPELNPFLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAIPPHFPLENLSPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQPEARMKLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELSNSRFPVPIDILYTSPNEGVVVQPQNGRSTLDGELLGTT
                     QIVPSNICALRGRINAHVPNEPNQWNLQVTNANGTPFDPTEDVPAPLGTPDFQANIYG
                     VTGQRNSDSSCRAHDGVLATWSPKFTPKLGSVVLGTWEKEDFNINQPTRFTPIGLHNT
                     EHFKQWVLPNYSGMLTLNMNLAPSVAPLFPGEQILFFRSFIPLNGGKSDGAIDCLLPQ
                     EWIQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVASSGSKPIVVPPNG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6698..7468
                     /gene="VP2"
     CDS             6698..7468
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="CRL46974.1"
                     /translation="MAGAFVAGLAGDIVTNSIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDQEMLQAQIQATKQLQADMIALRQGVLTAGGFSPTDAARGAVNAPMTQVLDWSG
                     TRYWAPGATKTTAFSGGFTSSPNTRTIVPKKTSATPASTSVSRPSSLASTASTRSTFV
                     SGTSSLSSSTRSSFNSQPTSSSSRTSEWVRSQNRVLEPYMRGSLQTAFVTPPSSRASS
                     NGTVSTVPKEVLDSWTSVFNTHRQPLFAHLRRRGESQV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctacta gcaacaacga
       61 catcgcaaaa tcttcaagtg acggagtact aagtagtatg gctgtcactt tcaaacgagc
      121 cctcggggcc cggcctaaac agccgccccc gagggaagca acacaaaaac aaaaacctcc
      181 acgaccgccc accccggaat taatcaaaaa gattccacct cccccgccca acggggagga
      241 cgacatagtg gtatcctaca gtgccaaaga tggagtctcc ggcctgcctg agctatccac
      301 cgtcaggcag ccgggtgaga caaacacagc atttagtgtc cccccactca accagaggga
      361 aaacagggat gctaaagaac cgctgcctgg ctccatcttg gagatgtggg acggagagat
      421 ctaccactat ggcttgtacg tggagcgggg cttggtgctt ggggtgcaca aaccaccagc
      481 ggctgttagc cttgcaaagg ttgaactaac accactgtct ctgtactgga gaccagtgta
      541 cacccctcag tacctcatat ccccggaaac tctcaaaaag ctacatggag agacattccc
      601 ttacacggcc tttgacaaca actgttacgc cttctgttgc tgggtcttgg acctaaacga
      661 ctcttggctc agcaggagga tgatacagag aacaactggc ttcttcagac cctaccagga
      721 ctggaacagg aaacctctcc ccactatgga tgattccaaa ttgaaaaagg tggccaatat
      781 agtcctgtgt gctttgtcat cactattcac caggcccatt aaggatataa taggaaaact
      841 aaggccttta aacatactta atatactagc ttcctgcgac tggactttcg caggagtagt
      901 ggaatcccta attctccttg cagaactctt cggagtttac tggacacccc cagatgtgtc
      961 tgcgttgatc gcccccttgc taggcgacta cgaactacag ggacctgaag atgtcgctgt
     1021 agaactcgta ccagtggtaa tgggggggat aggtttggtt ctaggtttca ccaaggagaa
     1081 gattggtaag atgctatcat ctgccgcgtc caccctcaga gcttgtaaag accttggtgc
     1141 atatggattg gaaattctga agctaatcat gaagtggttc ttcccgaaga aagaccaggt
     1201 aaatgagctt gcaatggtga ggtccattga ggacgcagta ctagacctcg aagcaattga
     1261 aaacaatcac ttgaccaccc tgctcaaaga caaagacagc ttagcaacct acatgaagac
     1321 tctggatctt gaggaagaga aagctaggaa actctccacc aaatccgctt ctcctgacat
     1381 tgtgggcaca atcaactcac ttctggcacg gattgcagct gcccgttccc tggtgcatcg
     1441 ggcaaaagaa gagctttcta gtaggccaag acccgttgtt gtcatgatat caggaaagcc
     1501 agggataggg aagacccacc ttgccaggga tttggcaaag aaggttgcgg ccaccctcac
     1561 aggagaccag agggtgggcc tcatcccacg gaatggtgtc gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtccttt gggacgacta tggaatgagt aatcccattc atgacgccct
     1681 taggctccaa gaactcgctg acacttgccc cttaacacta aattgtgata gaattgagaa
     1741 caaagggaag gtctttgaca gtgatgtcat aattatcaca actaatctgg ctaacccggc
     1801 accactggac tacgtcaact ttgaagcatg ttcgaggcgc atcgacttcc tagtgtatgc
     1861 tgatgccccc gacgttgaaa aggcaaaacg cgacttccca gggcaacctg acatgtggaa
     1921 ggatgctttt aaatctgact tctcacacat aaagttgatg ttggctcctc agggtggttt
     1981 tgacaagaac ggcaacaccc cacatggaaa aggtgtcatg aaaactctca catctggctc
     2041 cctcgttgct cgtgcttcag gactcctcca cgaaagactg gacgagtacg agttacaagg
     2101 accaacaccc acaaccttca atttcgacca aaacaaggtg ttcgccttta gacagctcgc
     2161 cgctgaaaat aagtacgggc tgatggacac catgagagtg gggagccagc tcaagaatgt
     2221 caaaactgtg tcagagctca aacaggcact taagaacatt tcaattaaaa ggtgccaaat
     2281 agtttacagt ggtctcacat attcacttga atctgatggc aaaggtaatg tgaggattga
     2341 gaaggtgcaa agtccagctg tgcagaccaa caatgagcta actggcgcac tacatcatct
     2401 gagatgcgct aggattagat attatgttaa gtgtgtccag gaagctttgt attccatcat
     2461 ccaaattgct ggagccgcgt ttgtcaccac gcgcattgca aagcgcataa acatacaaaa
     2521 cctctggtcc agaccacagg tggaagatga ggaagagacc accagcaaag acgggtgccc
     2581 gaaaccaaag gatgaggagg agtttgtcat ctcgtctgaa gacatcaaag ccgaaggcaa
     2641 gaagggaaag aacaaatctg gccgtggcaa gaaacacaca gccttctcga gtaagggcct
     2701 tagtgatgag gagtacgaag agtacaagag aatcagagaa gaaagaaatg gcaagtactc
     2761 catagaagaa tacctccaag acagagacaa gtactatgag gaggttgcca tagccagggc
     2821 tactgaagag gacttctgtg aggaagaaga agccaagatt cggcaaaggg ttttcagacc
     2881 aacaaggaaa caacgcaagg aggagagggc ttcactcgga ctggttacag gctcagaaat
     2941 caggaaaagg aacccggatg acttcaaacc taaaggaaag ttatgggctg atgatgacag
     3001 gagtgtcgat tacaatgaaa agctcagttt tgaagccccc ccaagcatct ggtcgagaat
     3061 agtcaacttt ggatcgggtt ggggcttctg ggtctcacca agtctcttta taacatccac
     3121 ccacgtcata cctcaagggg cacaagagtt cttcggtgtt cccattaaac agatccaaat
     3181 tcataagtca ggtgagttct gccgactaag attcccgaag ccaattagaa ctgatgtgac
     3241 aggtatgatc ctggaggagg gggccccaga aggcactgtg gccacactgc tcataaagag
     3301 gccaactggg gagctgatgc cactggcagc tagaatgggc acccatgcaa ctatgaagat
     3361 ccaaggtcga accgtcgggg gacagatggg gatgctcctg acaggatcca acgccaagag
     3421 catggatttg ggtaccacac caggtgactg tggatgccca tatatctaca aaagaggaaa
     3481 tgactacgtg gtcatcggag tccacacagc tgccgcccgc ggtgggaaca ctgtcatctg
     3541 tgcaactcaa ggaagtgagg gcgaggccgt acttgaaggt ggtgacaaca aaggcaccta
     3601 ttgtggcgcc ccaattctag gtccaggaaa tgcccccaaa ctcagtacta aaaccaaatt
     3661 ctggaggtcc tcaacagcac cactcccacc tggtacatat gaaccagctt acctcggagg
     3721 caaagacccc agggtaaaag gtggcccctc attacagcaa gttatgagag accaattgaa
     3781 accgttcaca gaacccagag gtaagccacc aaaacccagt gtgttggaag cagccaaaaa
     3841 gacaatcatc aatgtccttg agcaaacaat agacccaccc caaaaatgga cgttcgcaca
     3901 ggcgtgcgca tcccttgata aaacaacctc tagtggttac ccgcaccacg tgcggaagaa
     3961 tgaatattgg aatggagaat ctttcacagg gaaattggct gatcaggctt caaaagctaa
     4021 cttgatgttt gaagaaggaa aacacatgac accagtctac acgggagctc tcaaagatga
     4081 gttagtcaaa actgataaaa tatatggtaa gatcaagaaa aggttattat ggggttcaga
     4141 tctggcaacc atgatccgtt gcgctcgagc gttcggaggg ttgatggatg agctcaaggc
     4201 ccactgtgtc acactcccca tcagggtggg gatgaacatg aatgaggatg gtcccatcat
     4261 ttttgaaaaa cactctaggt atacctacca ttatgatgca gactactctc ggtgggactc
     4321 aacacagcag agagctgtct tagctgcagc tctggagatc atggtaaaat tttccccaga
     4381 accacaccta gctcagattg ttgcagaaga tctcctgtct cccagcgtga tggacgtggg
     4441 cgattttaaa atatcaatca ctgaaggact cccctctggg gtgccttgca cttcacagtg
     4501 gaattccatt gctcattggc tcctcacgct ctgtgctctc tctgaggtaa cagatttagc
     4561 tcctgacata atccaagcaa actcactctt ctctttctat ggtgatgatg aaattgtgag
     4621 cacagacatt aaattagatc cagaaaggct aacaaccaaa ctaaaagaat atggtctcaa
     4681 accaacccgc cctgacaaga ctgaagggcc tctgattatt tctgaggact tagatggtct
     4741 gaccttcttg cgaagaactg tgacccgtga cccagcaggt tggtttggaa aattggaaca
     4801 gagctcaata cttagacaga tgtattggac caggggcccc aatcatgagg acccctttga
     4861 aacaatgata ccacactccc aacgacccat acagctgatg tccctactag gtgaagctgc
     4921 attgcatggc ccatcgttct acagcaaaat cagcaaattg gtcatatcag agttgaaaga
     4981 aggtggcatg gacttttacg tgccaaggca agagccaatg ttccgatgga tgaggttctc
     5041 agacttgagc acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg
     5101 cgtcgaatga cgccgctcca tctaatgatg gtgcagccgg tctcgtacca gaggtcaata
     5161 acgagacgat ggcacttgag ccggtggctg gggcctccat agctgcccct ctaaccggcc
     5221 aaaacaatgt gatagacccc tggattagaa tgaattttgt tcaagcccca aatggtgaat
     5281 ttacagtgtc cccccgtaat tccccaggtg aagtgttgtt agaattggaa ttaggccccg
     5341 aattgaatcc attcctggca cacctttcaa gaatgtacaa tggttatgct ggtggggttg
     5401 aagtgcaggt gctacttgct gggaacgcgt tcacagcagg aaaactagtg tttgcagcaa
     5461 tccccccaca cttccctctt gagaatctga gtcctggtca aattacaatg ttccctcatg
     5521 taattattga tgttagaact ttagaacctg tccttttacc tttaccagat gttagaaata
     5581 acttctttca ttacaatcag cagcctgagg cccgtatgaa acttgtggct atgttgtaca
     5641 ctcctcttag atctaatggt tctggtgatg atgtgtttac agtctcttgt agggttctca
     5701 ctcgcccttc tccagatttt gattttaatt atttggtccc cccaactgtg gaatctaaaa
     5761 ctaaaccatt caccctgcca atattgacca ttggagaatt gtcaaattct aggttcccag
     5821 taccaataga tatattgtac accagcccta atgaaggagt ggttgtgcaa cctcaaaatg
     5881 gcagatcaac actcgatggt gaactgcttg gcaccacaca aattgtacca tcaaacatct
     5941 gtgccttgcg ggggcgcatc aacgcccatg tgccaaacga acccaatcaa tggaacttgc
     6001 aggttacaaa tgcaaatgga actccctttg accccactga agatgtccct gcgccattgg
     6061 gcacgccgga cttccaggca aacatctacg gagtcacagg tcagaggaac tctgacagct
     6121 cttgccgtgc ccatgatggg gttttggcaa cctggagccc taaatttaca cctaagctag
     6181 gatctgtggt cttgggtact tgggaaaaag aagattttaa tatcaatcag cctaccagat
     6241 tcacacctat tggtttgcat aatacagaac actttaagca gtgggttcta cccaattatt
     6301 ctggaatgtt gaccttaaac atgaatttgg caccctctgt tgctcccctc ttcccaggtg
     6361 aacaaatact cttctttagg tcctttatac cactcaatgg aggcaaatcc gacggtgcca
     6421 ttgactgtct actccctcag gaatggatcc agcatttcta tcaggaatca gccccatcac
     6481 ccacagacgt tgccctgatt aggtacacca atcctgacac gggccgcgtc ctctttgagg
     6541 ccaaattaca tagacaggga ttcattacag tagcaagttc tggttctaaa cctattgttg
     6601 tccctcctaa tggttatttt aggtttgatt cttgggttaa tcagttttat tctctcgccc
     6661 ccatgggaac tgggaatggg cgtagaaggg tgcagtaatg gctggagctt ttgtagcagg
     6721 gcttgccggt gatatagtca ccaacagcat tggttcactt gtgaacgctg gagccaatgc
     6781 aataaaccaa aaagtggatt ttgaaaacaa caaacaacta cagcaggcct ctttcaacca
     6841 tgatcaggaa atgttgcaag ctcaaattca ggccacaaaa caactacaag ctgacatgat
     6901 tgcgctcaga caaggggtgt tgaccgcagg cggcttctcc cctactgacg cagcgagagg
     6961 ggcggttaat gcgcccatga cgcaagtctt ggattggagt gggaccaggt actgggcccc
     7021 cggagccaca aaaacaactg ctttctccgg cgggttcaca agctccccca ataccaggac
     7081 tattgtgcct aagaaaacat cagccacacc agcctccaca tctgtgtcta gacctagttc
     7141 tcttgcttct actgcttcta cccgctcaac atttgttagc gggacttcta gcctttcttc
     7201 ttcgactagg agctctttta attcccagcc cacctcctct tcttctcgga ctagcgaatg
     7261 ggtgcgtagt caaaacaggg tgctggagcc ctacatgagg ggatcgttac aaactgcttt
     7321 cgtgacgcct ccctctagta gagcctccag caatggcaca gtctcaaccg tgccaaaaga
     7381 agttttggac tcctggacat ctgtgttcaa cacccacaga caaccgcttt tcgctcatct
     7441 ccgtcggaga ggggagtcac aggtttagtg aaaagatgat ttttctttct attctttttg
     7501 aaatttctgt ctttta
//