Typing tool

Complete norovirus genomes

LN854569  GII.3
 GII.P21

Length: 7,579 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6731
ORF3: 6731..7495
LOCUS       LN854569                7579 bp    RNA     linear   VRL 12-JUN-2015
DEFINITION  Norovirus GII/Hu/NL/2014/GII.21/Groningen, complete genome.
ACCESSION   LN854569
VERSION     LN854569.1
KEYWORDS    complete genome.
SOURCE      Norovirus GII/Hu/NL/2014/GII.21/Groningen
  ORGANISM  Norovirus GII/Hu/NL/2014/GII.21/Groningen
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Bavelaar,H., Rahamat-Langendoen,J., Niesters,H.G.M., Zoll,J. and
            Melchers,W.J.G.
  TITLE     Whole genome sequencing of faecal samples as a tool for the
            diagnosis and genetic characterization of norovirus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7579)
  AUTHORS   Zoll,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2015) Medical Microbiology, RADBOUDUMC, PO Box
            9101, 6500 HB Nijmegen, NETHERLANDS
FEATURES             Location/Qualifiers
     source          1..7579
                     /organism="Norovirus GII/Hu/NL/2014/GII.21/Groningen"
                     /mol_type="genomic RNA"
                     /strain="GII/Hu/NL/2014/GII.21/Groningen"
                     /host="Homo sapiens"
                     /db_xref="taxon:1665650"
                     /note="genotype:GII.21"
     gene            5..5104
                     /gene="POL"
     CDS             5..5104
                     /gene="POL"
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="CRL46969.1"
                     /translation="MKMASNDASAAAAAKSNNDNAKSSSDGVLSNMAVTFKRALGARP
                     KQPPPSDKPPKPPRPPTPELVKAIPPPPPNGEDGPIISYNVKGGVSGLPELSTVTQLE
                     ENSTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKIELAPLSLYWRPVYTPQYLISPDTLRKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKVKKVANVVLCALSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEKNELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDMEEEKARKLST
                     KSASPDIVGTINALLSRIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSSPVHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDTFKPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLVDTMRVGSQLKNVKTM
                     TELKQALKNISVKKCQLVYGGGTYTLESDGKGNVHVEKVNNTSVQTNNELSGVLHHLR
                     CARIRYYVKCVQEALYSILQIAGAAFITTRIAKRTNIQNLWSKPQAEDLEETNNEVGC
                     PKPKNDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRAVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGNEGEAMLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINMLEQTIDPPQKWTYAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGEVKKRLLWGSDL
                     STMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVMDVGDFRISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTKGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPSFYSKVSKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6731
                     /gene="VP1"
     CDS             5085..6731
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="CRL46970.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINNEAMALEPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFSLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNLDTTTRAHEAKIDTTSGRFTPKLGSLEISTESSDFDQSQP
                     TRFTPVGIGVDHEADFQQWTLPDYAGQFTHNMNLAPAVAPNFPGEQLLFFRSHLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPSQSQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPIIVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     gene            6731..7495
                     /gene="VP2"
     CDS             6731..7495
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="CRL46971.1"
                     /translation="MAGAFIAGLAGDMLTNTVGSLVNAGANAINQTIDLENNKYLQNA
                     SFNHDKEMLNAQIEATKKLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRHWAPGATSTTSMSGGFTHQTVHRSTPNFKTNQAPKSTPSSGSSVRSNSTQITSLSS
                     HSSGSSRSSGSTVIRSIPSSDRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgccaaaa gcaacaacga
       61 caacgcaaaa tcttcaagtg acggagtatt atctaatatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agccgccccc gagtgacaaa ccaccaaaac ccccaagacc
      181 acccacacca gagttggtta aggcaattcc ccctccccca cccaacgggg aggacggacc
      241 aatcatttct tacaacgtca aagggggtgt ttctggtttg cctgagctct caactgtcac
      301 ccaacttgaa gagaactcta cagcattcag cgttccccct cttagtcaga gggagaacag
      361 agatgcaaag gaaccattga ctgggaccat cctggagatg tgggacgggg agatctatca
      421 ttatggctta tacgtagaac gagggttagt gctcggtgta cacaaaccac cagcagccat
      481 cagccttgct aagattgagc tggccccctt gtctttgtat tggagaccag tgtacacccc
      541 acagtacctc atttcccctg acactctcag aaagttgcat ggggagacgt tcccttatac
      601 agcctttgac aacaactgtt atgccttctg ctgttgggtg cttgacttga acgattcatg
      661 gctgagcaga aggatgatac aaaggacaac aggcttcttc cgaccctacc aggactggaa
      721 caggaaaccc ctccccacga tggatgactc caaagtgaaa aaggtggcca atgttgtcct
      781 atgtgctctc tcatcattgt tcacaagacc aattaaggac attattggga agttaaaacc
      841 cctaaacatt ctcaacatct tagccacatg tgattggact tttgcaggca tagtagaatc
      901 cctgatcctt ttggctgaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgctccc ttactgggtg attatgaact acagggaccc gaggacctcg ctgtggaact
     1021 cgtacccgta gtaatgggag ggataggttt ggtgctggga ttcaccaaag agaaaatcgg
     1081 caagatgctt tcttctgctg cttcaaccct gagggcatgt aaagatctcg gtgcatatgg
     1141 gttggagatc ctcaaattgg tcatgaaatg gtttttccca aagaaagaag agaaaaacga
     1201 attggcaatg gtgagatcca tcgaggatgc ggtgctagac cttgaagcca ttgaaaacaa
     1261 ccatatgaca gctcttctca aggataaaga cagccttgca acctacatga ggactcttga
     1321 catggaggag gagaaggcga gaaaactttc caccaagtct gcctctccgg atattgtggg
     1381 cacgataaat gccctactgt caaggattgc agctgcccgg tctctagtgc acagggctaa
     1441 ggaggagctg tcaagcaggc cccgaccggt cgttgtaatg atttcaggga aaccgggtat
     1501 agggaaaacc catctagcta gagagttggc aaagaagatc gcctccacac tcacaggtga
     1561 ccagagggtg ggtcttatcc cacgtaacgg ggtcgaccac tgggatgcat ataaaggtga
     1621 aagagtcgtt ctctgggacg actacgggat gagcagccct gtccacgacg ccctcagact
     1681 tcaggagctc gctgatacct gtcctctcac actcaactgt gacaggattg agaacaaagg
     1741 taaagtcttt gacagtgacg tcataataat aaccaccaat ttggccaacc cagcaccact
     1801 ggattatgtc aactttgaag cttgctcgag acgcatagac ttcctcgtct atgctgatgc
     1861 tcctgaagtt gagaaggcca agcgggactt cccaggccaa ccagacatgt ggaaagacac
     1921 cttcaaaccc gacttctcac acataaaatt ggcattagcc ccgcaaggag gttttgacaa
     1981 gaatggtaac actcctcatg ggaagggagt catgaagacc ctcactgcca gttccctcgt
     2041 tgcccgagca tcagggctcc tccacgagag attagacgag tatgagctgc agggcccaac
     2101 tcccacaaca ttcaacttcg accgcaacaa ggtgcttgct tttaggcagc ttgctgctga
     2161 aaacaagtac ggtcttgttg acacaatgag ggtcgggtca caactcaaga atgtcaaaac
     2221 tatgacagaa ctcaagcagg ccctcaagaa tatctcagtc aagaaatgtc agcttgtgta
     2281 cggtgggggc acatacacac ttgagtctga tggcaaaggc aatgtgcatg tcgaaaaggt
     2341 gaacaacacc agtgtgcaaa ctaacaacga gctctccggg gttttgcacc atctcaggtg
     2401 tgctagaatc aggtactatg ttaagtgtgt tcaggaagct ctctactcca tcttacaaat
     2461 tgccggggct gcattcatca ccacgcgcat tgcaaagcgc acgaacatac aaaacctctg
     2521 gtccaaacca caagcagaag atctagagga gactaacaac gaggtgggtt gtccaaaacc
     2581 taaaaatgat gaagaatttg tcgtctcctc tgatgacatc aaaactgagg gtaagaaagg
     2641 aaagaacaag actggccgtg gtaagaagca cacagccttt tccagcaaag gactcagtga
     2701 tgaggagtac gatgagtata agagaatcag ggaagagaga aatggtaagt actccataga
     2761 ggaatatcta caggacagag acaaatacta tgaggaggtg gccatagcca gggcaactga
     2821 ggaagatttc tgtgaagaag aggaggccaa aatccggcag aggatattta gaccaacaag
     2881 gaaacaacgc aaagaggaaa gagcttctct tggtttggtt acaggctctg agatcaggaa
     2941 gagaaaccca gatgacttca agcccaaagg gaaactatgg gctgatgatg acaggagtgt
     3001 tgactacaat gagaaactta gtttcgaggc tccaccaagc atttggtcac gaatagtcaa
     3061 ctttggctca gggtggggct tttgggtctc gcccagcctc ttcataacat cgacccatgt
     3121 cattccccaa ggcgcgcagg agttctttgg agtgcccatc aaacaaatac aaattcacaa
     3181 gtcaggtgag ttctgccggc ttaggttccc gaaaccaatc aggacagatg ttacaggcat
     3241 gatcttggag gaaggtgctc cagaaggcac tgttgccaca cttctcatca agagaccaac
     3301 tggggaactc atgcccttgg cagccaggat gggcacccac gccaccatga aaatccaggg
     3361 tcgcgctgtt ggtggacaga tgggcatgct actcacaggg tctaacgcta agagcatgga
     3421 tttgggcaca acccctggcg attgtggttg tccctatatc tacaagaggg ggaatgacta
     3481 cgtggtcatt ggagttcaca ctgccgccgc tcgtggagga aacaccgtca tctgtgcaac
     3541 ccaaggaaac gagggtgagg ccatgctaga aggtggtgac aacaagggaa cttattgtgg
     3601 agcaccaata ttaggccctg gaaatgcccc caaactcagc accaaaacca aattctggag
     3661 gtcttccacc actcccctgc cacccggaac ctatgagcca gcttatctgg gtggcaagga
     3721 ccctagagtg aaaggtggcc cctcactgca acaggttatg agagaccaac taaaaccatt
     3781 cactgagcct agaggcaaac cacccaaacc aagtgtgcta gaagctgcca agaagactat
     3841 aatcaatatg cttgaacaaa caatagaccc acctcaaaaa tggacatacg cacaagcgtg
     3901 tgcatcacta gacaagacca cttccagcgg tcaccctcac cacatgcgga agaacgattg
     3961 ctggaacggg gaatctttca caggaaaact ggcagaccaa gcatcaaagg ccaacctaat
     4021 gtttgaggaa ggaaagaaca tgactccagt atacacaggg gctctgaaag atgagctagt
     4081 caagactgac aagatctatg gggaggtcaa gaagaggctc ctgtggggtt cagacctatc
     4141 aaccatgata cggtgtgcac gagccttcgg tgggctaatg gacgagctca aggcccattg
     4201 cgtcacacta ccagtcaggg ttggtatgaa catgaatgag gatggaccca taatatttga
     4261 gaaacactcc agatacaaat accattatga tgcagattac tcccgctggg actcaacaca
     4321 acaaagagca gtgctagccg cagccctgga aataatggtc aaattctcac cagaacccca
     4381 cctggcccag gtggttgcag aagacctttt gtcccccagt gtgatggatg tgggtgactt
     4441 caggatatca atcaacgagg gattgccctc tggtgtccct tgcacttcac aatggaactc
     4501 cattgctcac tggctcctca cactatgtgc actgtctgaa gtcacagacc tgtcccctga
     4561 catcatccag gcgaattccc tgttctcctt ttatggtgat gatgaaatag tgagcacaga
     4621 catcaaatta gacccagaga aattgacagc aaagctgagg gaatacgggc ttaaaccaac
     4681 ccgccccgac aaaacagagg gacccttaat tatctctgaa gatttgaatg gcctgacctt
     4741 cttgcggaga acagtgaccc gcgatccggc cggatggttt ggcaaactgg accaaagttc
     4801 aatactcagg cagatgtact ggaccaaggg gccaaaccat gaagacccct ttgaaacaat
     4861 gataccacac tcccaaagac ccatacaact gatgtcatta cttggtgaag ctgcattgca
     4921 tggtccatca ttctacagta aagtcagcaa attggtcatc tcagaactga aagagggtgg
     4981 aatggatttt tacgtgccca gacaagaacc aatgttcagg tggatgagat tctcagattt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctaat gatggtgccg ccggcctcgt cccagagatc aacaatgagg
     5161 caatggcgct agagccagtg gcgggtgcag cgatagcagc acccctcact ggtcagcaaa
     5221 atataattga tccctggatt atgaataatt ttgtgcaagc acctggtggt gagtttacag
     5281 tgtcccccag aaattcccct ggtgaagttc ttcttaattt ggaattgggc ccagaaataa
     5341 atccctattt ggcccatctt gctagaatgt ataatggtta tgcaggtgga tttgaagtgc
     5401 aggtggtcct agctggaaat gcgtttacag caggaaagat aatctttgca gctattcccc
     5461 ccaactttcc aattgacaat ttaagtgcag cacagatcac tatgtgccca catgtgattg
     5521 tagatgtcag acagttggaa ccagtcaacc tcccgatgcc tgacgttcgc aataacttct
     5581 ttcattataa tcaagggtct gattcgaggt tacgcctaat tgcaatgcta tatacacctc
     5641 ttagagcaaa caattctggg gatgatgttt ttactgtgtc ttgtagagtg ctaactagac
     5701 ctagtcctga cttctcattc aatttccttg tgccacctac tgtggagtca aagacaaaac
     5761 ccttctccct ccctatcctg actatttctg aaatgtctaa ttctaggttc ccagtaccaa
     5821 ttgattctct gcacaccagt cctactgaga atattgttgt tcagtgccaa aatgggcgcg
     5881 tcacccttga tggtgagttg atgggcacca cccaactctt gcctagccaa atctgtgctt
     5941 tcaggggagt tctcaccaga tcaacaagca gggccagtga ccaggccgat acagcaaccc
     6001 ctagattgtt taattattat tggcatatac aattggataa tctaaatgga accccttatg
     6061 atcctgcaga agacatacca ggccccctag ggacaccaga tttccgtggc aaagtctttg
     6121 gcgtggccag ccagagaaat cttgatacca cgactagggc acatgaagca aagatagaca
     6181 ccacatctgg ccgcttcacc ccaaagctag gctcattaga aatatccact gaatctagtg
     6241 attttgatca aagccaacca acaagattca ccccagttgg cattggagtt gaccatgagg
     6301 cagactttca acaatggacc ctacccgact acgctggtca gttcacacac aacatgaact
     6361 tagcaccagc tgttgctccc aacttccctg gtgagcagct ccttttcttc cgctcacatt
     6421 tgccatcttc tggtgggcga tctaacggga ttctagactg cctggtcccc caagaatggg
     6481 tacagcactt ctaccaagag tcagccccct ctcagtctca agtggccctg gttaggtatg
     6541 ttaaccctga cactggtaga gtgttatttg aggccaagct acacaaattg ggtttcatga
     6601 ctatagccaa gaatggtgat tctccaataa ttgttcctcc aaatggatac tttaggtttg
     6661 aatcttgggt gaaccccttt tacacacttg cccccatggg aactgggaat gggcgtagaa
     6721 ggattcaata atggctgggg cttttatagc aggattggct ggtgacatgc tcacaaatac
     6781 tgtaggatct ttagttaatg caggagctaa tgctattaat caaacaattg atttagaaaa
     6841 taataaatat ttgcaaaatg cttcttttaa tcatgataag gagatgttga atgcacaaat
     6901 tgaggcaaca aagaagttac aggctgacat gattgctatc aagcaagggg tcttgaccgc
     6961 tggcggcttc tcccctactg atgcagcccg tggggcaatt aatgccccca tgacaaaagt
     7021 cctagattgg aatggaacga gacactgggc accaggtgcc acctccacaa cctcgatgtc
     7081 gggtggcttt acacatcaaa ctgtgcacag atccacacca aattttaaaa cgaaccaggc
     7141 tcccaaatcc acacccagca gtgggtcttc agtgaggtca aactcaaccc aaatcactag
     7201 cctgagttca cactcgtccg ggtcgtctcg atccagcggg tctacagtta tcagatcaat
     7261 accatcctct gacaggacta gggactgggt caaccaacaa aattttaatt tggaaccaca
     7321 tatgcctgga tctcttagga cagcttttgt cactccacca tctagtacag cctctagctc
     7381 aggcacagtc tcaactgtgc ccaaaaatgt tttggactcc tggacatctg cgttcaacac
     7441 gcgcagacag ccgctattcg cacaccttcg cagaaggggg gagtcaaatg tttagtgaaa
     7501 agattatttt aaatttggtt taaattaggt ttaatttgga atcttttaaa aaaaaaaaaa
     7561 aaaaaaaaaa aaaaaaaaa
//