Typing tool

Complete norovirus genomes

LN854568  GII.6
 GII.P7

Length: 7,550 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6722
ORF3: 6722..7498
LOCUS       LN854568                7550 bp    RNA     linear   VRL 12-JUN-2015
DEFINITION  Norovirus GII/Hu/NL/2014/GII.6/Groningen, complete genome.
ACCESSION   LN854568
VERSION     LN854568.1
KEYWORDS    complete genome.
SOURCE      Norovirus GII/Hu/NL/2014/GII.6/Groningen
  ORGANISM  Norovirus GII/Hu/NL/2014/GII.6/Groningen
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Bavelaar,H., Rahamat-Langendoen,J., Niesters,H.G.M., Zoll,J. and
            Melchers,W.J.G.
  TITLE     Whole genome sequencing of faecal samples as a tool for the
            diagnosis and genetic characterization of norovirus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7550)
  AUTHORS   Zoll,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2015) Medical Microbiology, RADBOUDUMC, PO Box
            9101, 6500 HB Nijmegen, NETHERLANDS
FEATURES             Location/Qualifiers
     source          1..7550
                     /organism="Norovirus GII/Hu/NL/2014/GII.6/Groningen"
                     /mol_type="genomic RNA"
                     /strain="GII/Hu/NL/2014/GII.6/Groningen"
                     /host="Homo sapiens"
                     /db_xref="taxon:1665649"
                     /note="genotype:GII.6"
     gene            5..5098
                     /gene="POL"
     CDS             5..5098
                     /gene="POL"
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="CRL46966.1"
                     /translation="MKMASNDATAAFGSQNSVNDSINTAPSNKEEVGAFSNIKVGFKK
                     MLGAVPKGTKAPSSDQHCPLVKIGTKTLTVPPEPPNGEDTVQFDAKSETVRGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPATEPLPGTILEMWDGEFYHYSVYVSGGKALGVHKPP
                     AAISLATIELTPISLYWRPVYTPNYLVCPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLSRRSISRTTGFFKPYQSWNRKPLPTVDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNIFWTPPDVSSFIASLIGDFELQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRVDFLVYAESP
                     EIEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGTALKS
                     VKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDKVEDQTSQTANEVGAAL
                     LRLRQARARYYVSCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPTETQETSESEK
                     EVAQGRWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEFKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTKKQRKEERGVLGLVTG
                     SDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGIKELFGVEIKQIQIHKSGEFCRFRFPRPIRPDVTGLVLEEGAPEGTV
                     CSILVKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNENLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPAVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHVRKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHVQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MIRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPMKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVISEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     gene            5079..6722
                     /gene="VP1"
     CDS             5079..6722
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="CRL46967.1"
                     /translation="MKMASNDAAPSNDGAANLVPEATSEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVENISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQENTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAPIDMLYTDPNEAIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICSFRGTLISQTSRSADSTDSAPRVRNHPLHVQLKNLDGTPYDPTDEVPAVLG
                     AIDFKGTVFGVASQRNTTGSSIGATRAHEVHIDTTNPRYAPKLGSVLMYSESTDFDDG
                     QPTRFTPIGMGADDWHQWELPEYSGHLTLNMNLAPAVAPAFPGERILFFRSVVPSAGG
                     YGSGHIDCLIPQEWVQHFYQEAAPSQSAVALIRYVNPDTGRNIFEAKLHREGFITVAN
                     SGNNPIVVPPNGYFRFEAWVNQFYTLTPMGTGQGRRRVQ"
     gene            6722..7498
                     /gene="VP2"
     CDS             6722..7498
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="CRL46968.1"
                     /translation="MAGAFLAGLVGDAITSGVGSLINAGANAINQKVEYDFNKQLQLA
                     SFKHDKEMLQSQVLATKQLQQEMMNIRQGVLSAGGFSPTDAARGAVNAPMTKILDWNG
                     TRYFAPNSMKTTSYSGQFSSNPVHRQPTSPRSDPPKIKVNSDSASVYSSASSAPSQST
                     HSTALTAGSSSSRTTSSSAAASTLSRTSDWVRGQNERLSPFMDGALQTTFVTPPSSKA
                     SSYGSVSTVPKAVLDSWTPMFNTHRQPLFAHVRRRGESQI"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgctgccttt ggcagccaaa actctgtcaa
       61 cgacagtatc aacaccgccc cttctaataa agaagaggtt ggtgcattct ccaacattaa
      121 agttggtttt aagaaaatgc tgggtgccgt tcccaagggg accaaagcac ccagtagtga
      181 tcagcactgc cccttagtta agattgggac caagacattg acagttcccc ctgagccccc
      241 aaatggtgaa gacaccgtgc agtttgatgc gaagtcggaa acagtgcgcg ggctaccaga
      301 cttgacaacg gtgcagaatg aacacgaaaa cacaccatac accgtccccc cattgagtga
      361 aagggagcac aggccagcca ctgaaccgct tcctggcaca atactggaga tgtgggatgg
      421 tgaattctac cattactctg tgtacgtcag cggtggcaaa gccctagggg ttcacaagcc
      481 ccctgcagca ataagcctcg cgacgataga gctcacaccc atatcccttt attggaggcc
      541 cgtttacacc cccaactatc tggtctgtcc agacacgttg aaaggccttg ctggtgagaa
      601 gttcccctac acggccttca gcaacaactg ttacaacttc tgttgctggg tgcttgagct
      661 caatgacacg tggcttagca ggagaagcat ctctaggact accggcttct tcaagccata
      721 tcagtcctgg aacaggaaac cccttccaac cgttgatgat ggaaagatca agaaggtggc
      781 caacgcaatt ctctgtgcac ttggatcact gttttcaaaa ccaatcaagg acctattggg
      841 caaactcaaa ccattgaacc tgctgcactt gctcgcatca tgtgactgga cgtttgcggg
      901 tatagtagag acagtcatcc taatggcgga acttttcaac atcttttgga caccgccaga
      961 tgtttccagt ttcatagcct ccctgatagg tgattttgaa ttacaagggc ctgaggacct
     1021 ggctgtggag cttgtccccg tggtcatggg tggcatagga atggttctcg gctttactgc
     1081 tgagaagata ggccgcatgc tgtcgtccgc tgcatcaaca ctacgggcat gcaaagactt
     1141 ggggaattat gcccttgaca tattgaaact ggttatgaag tggttcttcc caaagaaaga
     1201 agagaaagcc gagatggaaa ccctaagggc gattgaggat gccgtcctgg acatggaagc
     1261 tataggaaat aaccatctca caaccctcct caaggacaag gatagcctca cggctttcat
     1321 gaagactcta gatctagaag aggagaaggc aaggaagctg tccaccaagt catcctcgcc
     1381 agacatcgtc ggcactatta atgccatact ggccagaata gctgctgcca ggtccctctt
     1441 gcacaaggct aaagaagaaa tgtttagcag gatcagaccc gtggttgtca tgatctcggg
     1501 tagacctggc attggtaaaa cccacatggc aagacacttg gctaagagta tcgccaacac
     1561 catgagcggc gaccagagag taggactcgt cccacgcaac ggggtcgatc attgggacgc
     1621 ctacagggga gagagggtgg tcttatggga tgattatggc atgggaaacc ctgtcaaaga
     1681 tgccctaaca ctgcaagagt tggccgacac ctgcccagta actctaaact gtgataggat
     1741 cgagaacaag gggaagatgt ttgacagtga tgtcatcata atcacgacca atttagtcaa
     1801 cccagcgccc ctcgattatg taaacttcga ggcgtgctcc agaagggtcg actttctggt
     1861 ctatgcagag tcaccagaaa ttgagaaggt taagagagat ttccccggcc aacctgacat
     1921 gtggaaggac cattttaagc cagacttttc ccacataaaa ctgactctag ccccacaggg
     1981 tggatttgac aagaatggca acaccccgca tggtaagggc actatgcgat ccctaaccca
     2041 gggttccctg actgcaaggg ttgcaggtct tgttcatgag aggagagacg agtttcaact
     2101 ccaggggaac gaccttcaaa catacaactt tgacaccaac agggtctctg catttaggaa
     2161 gctggccgca gacaacaagt atgggatcat ggagactatg agagtgggca cagcgcttaa
     2221 gagtgtcaag accttggagg atctgaaagt tgcactgagg gatgtgaagt tcaatgagtg
     2281 tgagataatt tacagaaact ccaaataccg agtctcttct aatggtaaag gttctgtctc
     2341 tgttgacaaa gttgaggacc aaacatccca gactgcaaac gaagtgggtg cagcactcct
     2401 tagactcagg caggcaagag ccagatacta tgtcagctgc ttccaagatc tcgtttacac
     2461 tctaatacag gtcgccggag catcattcgt tgtcaacagg atctctaaaa ggttctgctg
     2521 ggagagatgg gtcaaaccaa ccgagaccca ggaaacgagt gaatccgaaa aggaagtggc
     2581 ccaaggcaga tgggagattg agcccaagga cacagaacca gaaggtaaga agggtaagaa
     2641 caagaaagga agaggcaaga aacacacagc tttctccagc aaaggcctaa gtgatgagga
     2701 gtatgacgag ttcaagagaa tcagagaaga aaggaacgga aaatactcca ttgaggaata
     2761 cctgcaagac cgggatcgct attatgagga agtggcagtt gcccgggcga cagaggagga
     2821 cttctgtgaa gaggaggagg ccaagataag acaaagaatc tttcgcccca cgaagaaaca
     2881 gaggaaggaa gaaagggggg tgcttggttt ggtcactggc tcagacatca ggaagagaag
     2941 accagacgat tttcaaccga agggtaacct gtgggcagac gacaccagga gtgtggacta
     3001 caacgagaga cttgatttcg aggcgcctcc gagtgtctgg tcgagaatag tcccattggg
     3061 cactggctgg ggcttctggg tctcatcaaa cctcctgatc acaacaacac acgtcctgcc
     3121 taaggggatt aaggaacttt ttggagttga aatcaaacag attcaaatcc ataagtctgg
     3181 agagttctgc aggttcaggt tcccgagacc aattagacca gatgtcacag ggctcgtgtt
     3241 ggaggaaggc gctccagaag gcactgtctg ctccatactc gtaaagagac ctacaggtga
     3301 gatgatcccc ctggcagtga ggatgggcac gcatgcatcc atgaaaatac agggcaggac
     3361 cgtcggtggc cagatgggaa tgctcctcac aggggcaaat gcgaagaaca tggatcttgg
     3421 caccggtcct ggtgactgcg gttgccctta catctacaaa cgtggcaatg atatagttgt
     3481 cgcgggtgtc cacaccgcgg cagcccgggg aggcaacact gtcatatgtg ccactcaagg
     3541 acaagatggg gaagcagtcc ttgagggaaa tgagaacctt ggcacttact gcggtgcccc
     3601 aatcttgggt ccaggcaagg cgcccaaact tagcacgaag accaagttct ggcgctcatc
     3661 accagacgcc ttgccgccag gcacttatga gcctgcctac ttgggaggta aggaccccag
     3721 agtggaaaaa ggaccatctc tgcagcaagt catgagggac cagctaaaac ctttcacaga
     3781 acccaggggc aagccaccta gacctgcagt cttagaagag gccaaaaaga cagtgatgaa
     3841 tgttctagag caaaccattg accctgctaa gccgtggacc tattcccaag catgtgcctc
     3901 actggacaag accacttcca gtggtagccc ccatcatgtc aggaaaaatg accattggaa
     3961 tggggaatcc ttcactggcc cccttgcaga ccaagcatcc aaagccaacc tcatgtacga
     4021 gcaggccaaa catgtgcagc ccgtgtacac ggccgcactt aaagatgaac tagtcaaaac
     4081 tgacaagatc tacaagaaga taaagaaaag gctcttatgg gggtcggatc ttggtacaat
     4141 gatcaggtgt gccagggcct ttggcggtct catggatagc atgaaggcaa gttgcatagc
     4201 cctcccatgt agggtgggga tgaacatgaa tgaagatggt cccatcatat ttgacaaaca
     4261 ttctaagtat aggtatcatt atgatgctga ctattccagg tgggactcaa cccagcaaag
     4321 gagcattctc tcggccgcta tggaggtgat ggtgcggttc tctgccgaac cagagctggc
     4381 acaagtggtt gcagaggacc tcctggcacc cagccaacta gatgttggcg atttcgtcat
     4441 ctcagtccag gagggtctgc catcaggggt tccatgcaca tcacaatgga attcaatagc
     4501 acactggatc ctaaccttga gtgcaatggc agaagtgtcg ggtctctcac cagatgttgt
     4561 tcaagcccac tcctgtttct cattctacgg tgatgatgag atcgtcagca ctgacatcaa
     4621 ccttgatccc atgaagttga cacagaaact cagagagtat ggcctggtcc ccactcgacc
     4681 tgacaaaact gagggtcccc tcgtaataac tgaagacctc accggcctaa cgttcctgcg
     4741 taggtcaatt gcacgggacc cagctgggtg gtttggaaaa ttggaccaag attcaatcct
     4801 cagacagttg tactggacaa ggggccccaa tcatgagaac ccatatgaga gcatggtccc
     4861 tcattcccag cgggctacac agcttatggc ccttctcggt gaggcttcac tgcatggccc
     4921 ccagttttac aagaaggtta gcaagatggt cattagtgag atcaaaagtg gtggtctgga
     4981 attctatgtg cccagacaag aggccatgtt cagatggatg agattctctg acctcagcac
     5041 gtgggagggc gatcgcaatc ttgctcccga gggtgtgaat gaagatggcg tcgaatgacg
     5101 ctgctccatc gaatgatggt gctgccaacc tcgtaccaga ggccaccagt gaggttatgg
     5161 cacttgagcc ggtggtggga gcctcaattg ctgctcctgt cgtcggccaa caaaatataa
     5221 ttgacccctg gattagagaa aattttgttc aggcaccaca gggtgagttt actgtttcac
     5281 caaggaactc acctggtgag atgcttctaa atcttgaatt aggccctgag ctcaatcctt
     5341 atctgagtca cttgtcccgc atgtataacg gctatgctgg tggtatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggta aaatcatctt tgccgccgtc ccaccacatt
     5461 ttcctgttga gaacattagt gcagcccaaa ttacaatgtg cccccatgta attgttgatg
     5521 tgagacagct tgagccagtg cttttgcccc tccctgacat aaggaataga ttctttcatt
     5581 ataatcagga aaataccccc cggatgagac ttgtggctat gttgtataca ccccttagag
     5641 caaattctgg tgaggatgtg tttacggtgt cttgcagagt tctgacccgc cctgcccccg
     5701 actttgagtt cacgttcttg gtgccaccaa ctgtggagtc aaagactaag ccctttacac
     5761 tccctatttt aactcttggt gagctatcca actccagatt ccccgctccg atagacatgt
     5821 tgtacactga ccctaatgag gcaattgtgg tgcaaccaca aaatggcagg tgcactctag
     5881 atggaacact tcaagggacc acccaactgg tacccaccca aatttgctcc ttcaggggca
     5941 cgctaattag ccagacgtcg aggtctgcag attcaacaga ttcagcccca cgggtgagga
     6001 accaccctct ccacgttcag ctgaagaacc tcgatgggac accatatgac ccaacagatg
     6061 aggtgccagc agttttgggt gccatagact tcaaaggaac tgtgtttggg gtcgctagtc
     6121 aaagaaacac cacagggagc tctataggag caacccgcgc ccatgaagtg catatagata
     6181 ccacaaaccc tagatatgcc ccaaagcttg gctctgtgtt gatgtattct gaatctactg
     6241 attttgatga tggacaaccc acccgcttca cccccattgg catgggagcc gatgattggc
     6301 accaatggga attacccgag tattctggtc accttactct taacatgaat ttggcccccg
     6361 cagttgcccc tgctttccct ggtgagcgca tcctcttctt cagatcagtg gtgccatctg
     6421 ctggtggcta tggatcaggt cacatagatt gcctcatccc acaggagtgg gttcagcatt
     6481 tttaccagga ggccgctcca tcacagtctg cggtggctct catcagatat gtcaaccctg
     6541 acactggaag aaacatcttt gaggcaaaac tgcatagaga agggttcatc actgtggcaa
     6601 attctggaaa caaccccata gttgtgcccc caaatggtta cttcaggttt gaggcctggg
     6661 tcaatcaatt ctacacactc acccccatgg gaactggaca ggggcgcagg agagttcaat
     6721 aatggcagga gcatttttag ctggattggt aggtgacgcc ataacaagtg gtgtcgggtc
     6781 cctaatcaat gctggggcca atgcaattaa ccaaaaggta gagtatgatt ttaataaaca
     6841 gctccaattg gcatccttca aacatgacaa ggagatgttg cagtcacaag tactggccac
     6901 taaacagctc cagcaggaaa tgatgaacat aaggcaaggg gtcttgtccg ctggcggctt
     6961 ttcccctaca gatgccgcga gaggtgctgt gaacgcgccg atgacaaaaa ttttggattg
     7021 gaatggaaca aggtacttcg ccccaaatag tatgaagaca accagttatt cgggccagtt
     7081 ttccagcaac cctgtacata ggcaacccac ttcaccccgt tctgaccccc caaaaatcaa
     7141 ggttaatagt gattctgcta gtgtgtatag ttctgcatct tctgctcctt cacaatcaac
     7201 ccactcaacg gctttgactg cggggtctag ctcatctagg acaacatcct cttctgcagc
     7261 tgcttccact ctatctagaa ccagtgactg ggtgagagga caaaatgaga ggcttagccc
     7321 gtttatggat ggtgctctcc aaacaacttt tgtcacacca ccatcgagca aggcttcatc
     7381 atatgggtcg gtctcaaccg ttcccaaagc tgttttggac tcctggactc ctatgtttaa
     7441 tacccatagg cagcctctct tcgctcatgt gcgcaggcga ggggagtcac agatttagtg
     7501 aaaagattga ttaggttttc tttctttctt cttttccttt tctttctttt
//