Typing tool

Complete norovirus genomes

LN854567  GII.4 Sydney
 GII.P31

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       LN854567                7559 bp    RNA     linear   VRL 12-JUN-2015
DEFINITION  Norovirus GII/Hu/NL/2014/GII.4/Groningen02, complete genome.
ACCESSION   LN854567
VERSION     LN854567.1
KEYWORDS    complete genome.
SOURCE      Norovirus GII/Hu/NL/2014/GII.4/Groningen02
  ORGANISM  Norovirus GII/Hu/NL/2014/GII.4/Groningen02
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Bavelaar,H., Rahamat-Langendoen,J., Niesters,H.G.M., Zoll,J. and
            Melchers,W.J.G.
  TITLE     Whole genome sequencing of faecal samples as a tool for the
            diagnosis and genetic characterization of norovirus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Zoll,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2015) Medical Microbiology, RADBOUDUMC, PO Box
            9101, 6500 HB Nijmegen, NETHERLANDS
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus GII/Hu/NL/2014/GII.4/Groningen02"
                     /mol_type="genomic RNA"
                     /strain="GII/Hu/NL/2014/GII.4/Groningen02"
                     /host="Homo sapiens"
                     /db_xref="taxon:1665648"
                     /note="genotype:GII.4"
     gene            5..5104
                     /gene="POL"
     CDS             5..5104
                     /gene="POL"
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="CRL46963.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     EINTAFSVPPLNQRENRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKIELTPLSLYWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSALFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACRDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIATSLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGMMDTMRVGKQLKDVKSM
                     SDLKQALKNITIKKCQIVYNGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     SARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMTNTDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGTIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRDVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVMDVGDFQISISEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIELNPEKLTAKLK
                     EYGLKPTRPDKTEGPLVITEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6707
                     /gene="VP1"
     CDS             5085..6707
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="CRL46964.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSDFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHTTGSRNYTMNLASQNWNNYDPTEETPAPLGTPDFVGKIRGML
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFETDTDNDFDANQNTKFTPVGVIQDG
                     TTTHRNEPRQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQFFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGPHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAV"
     gene            6707..7513
                     /gene="VP2"
     CDS             6707..7513
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="CRL46965.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAVLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAAPARGSSSKSS
                     NSFTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 catcgcaaaa tcttcaagtg acggtgtgtt ttctaacatg gctgtcactt ttaagcgggc
      121 cctcggggcg cggcctaaac agccgccccc gaaagaaata ccacccagac ccccgcgacc
      181 acccacacca gaattggtca aaaagatccc ccctccccca cccaacgggg aggatgaact
      241 agtggtctct tatagcgcca aagatggcgt ttccggactg cctgagctca ccactgtcag
      301 acaaccggaa gaaatcaaca cggcgttcag tgtcccccca ctcaaccaaa gggagaacag
      361 ggacgccaag gagccactaa ctggaacaat tattgaaatg tgggatggag aaatctacca
      421 ttacggcctg tacgtggaac gaggccttat acttggtgtg cacaagccac cggcagccat
      481 cagccttgcc aagatcgagc taacaccgct ctctttgtac tggagacctg tgtacacccc
      541 ccagtatctc atctctccag acactcttag gagattacat ggagagtcat tcccctacac
      601 tgcatttgac aacaattgct acgccttttg ttgttgggta ttagacctaa acgactcatg
      661 gctaagcagg agaatgattc agagaacaac aggtttcttc aggccgtacc aggattggaa
      721 caggaaaccc ctccccacta tggatgactc caaattaaag aaggtagcca acatattctt
      781 gtgcaccttg tctgcactat tcaccagacc cattaaggac ataataggga agttgaaacc
      841 tcttaacatc ctcaacattc tggctacatg tgattggacc ttcgcaggca tagtggaatc
      901 tttaatactc ttagcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttgctaggtg attatgaact gcaaggacct gaggaccttg cagtggaact
     1021 ggtcccaata gtgatggggg ggataggttt ggtgctagga tttaccaaag agaaaattgg
     1081 aaagatgcta tcatccgctg catccacttt aagagcttgt agagaccttg gtgcatacgg
     1141 actggaaatc ttaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 actggctatg gtgaggtcca tcgaggatgc agtgctagac ctcgaggcaa ttgaaaacaa
     1261 ccacatgacc accctactca aagacaaaga cagcttggca acctacatga gaacccttga
     1321 ccttgaagag gagaaagcca gaaaactctc aaccaaatct gcttcacccg acattgtggg
     1381 cacaatcaac gctcttctgg caagaatcgc tgctgcacgc tccctagtgc atcgggcgaa
     1441 agaagagctc tccagcaggc cgagacctgt cgttgtgatg atatcgggaa gaccagggat
     1501 agggaaaact caccttgcca gggagctggc caagaagatc gcgacctccc tcacagggga
     1561 ccagcgtgtg ggtcttatcc cacgcaatgg tgtcgatcac tgggacgcat acaagggcga
     1621 aagggttgtc ctatgggacg actatggaat gagcaacccc atccatgatg ccctcaggtt
     1681 gcaggagctt gctgacactt gccccctcac gctaaattgt gacagaatcg agaacaaagg
     1741 gaaagtcttt gacagtgatg ccataattat caccaccaat ctggccaacc cagcaccact
     1801 ggattatgtc aactttgaag cgtgctcgag acgtattgac ttcctcgtgt acgcagaagc
     1861 ccctgaggtg gagaaggcaa agcgcgattt cccaggtcaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gacttctcac acataaaact gtcattggct ccacagggtg gttttgacaa
     1981 gaacggcaac accccgcatg gaaaaggggt catgaagacc ctcaccactg gctccctcat
     2041 cgcccgagca tcagggttgc tccatgagag gctagatgaa tatgaactgc aaggcccagc
     2101 cctcaccacc ttcaactttg accgcaacaa gatacttgct tttagacagc ttgctgctga
     2161 aaacaagtat gggatgatgg acacaatgag agttggaaaa cagctcaagg acgtcaagtc
     2221 catgtcagac ctcaaacaag cactcaagaa catcacgatc aagaagtgcc agatagtgta
     2281 caatggtggc acctacacac ttgaggccga tggcaagggt agtgtgaaag ttgacaaagt
     2341 gcaaagtgcc actgtgcaga ccaacaatga actagccggt gccctacacc acctaaggag
     2401 cgctagaatc agatactatg ttaagtgcgt tcaggaggca ctgtattcca tcatccaaat
     2461 cgctggggcc gcattcgtca ccacgcgcat cgctaagcgc atgaatatac agaatctctg
     2521 gtccaagcca caggtggaag acacagaaga gatgaccaac acagatggtt gcctaaaacc
     2581 caaagatgat gaggagtttg tcgtctcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaagaacaag tccggtcgtg gcaagaaaca cacagccttt tcaagcaaag ggctcagtga
     2701 tgaggagtac gatgagtaca agagaatcag agaagaaagg aatggtaagt actccataga
     2761 agagtacctt caggacagag acaagtacta cgaggaggtg gccattgcca gggcaaccga
     2821 agaggacttc tgtgaagaag aagaggccaa aatccggcag agaattttta gaccaacaag
     2881 gaaacaacgc aaagaagaga gggcctctct cggcttggtc acaggctctg aaatcaggaa
     2941 gaggaaccca gaagacttca aacccaaggg aaagctgtgg gctgatgatg acagaagtgt
     3001 tgactacaat gagagactca actttgaggc cccaccaagc atctggtcgc ggatagtcaa
     3061 ctttggttca ggctggggct tctgggtctc ccccagtctg tttataacat caacccatgt
     3121 cataccccaa ggtgcaaaag agttcttcgg agtccctatc aagcaaatcc agatacacaa
     3181 atcaggtgaa ttctgccggt tgagattccc aaagccaatc agaactgatg tgacgggcat
     3241 gattctagaa gaaggtgcgc ccgaggggac cgtggccaca ctgctcatca aaagaccaac
     3301 tggagagctc atgcctctgg cagccaggat ggggacccat gcaaccatga aaattcaggg
     3361 gcgcacagtt ggggggcaaa tgggtatgct cctgacagga tccaacgcca agagtatgga
     3421 cctaggcaca acaccaggcg actgcggctg cccctacatc tacaagaggg ggaatgacta
     3481 cgtggtcata ggagtccata cggccgctgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaggggagt gagggagaag ccacacttga aggaggtgac agtaaaggta catactgtgg
     3601 tgcaccaatc ttgggcccag ggagcgctcc gaagctcagt accaagacta agttttggag
     3661 atcatccaca acaccactcc cacctggcac ctacgaacca gcctacctcg gtggcaaaga
     3721 ccccagagtc aaaggtggcc cttcattgca acaagttatg agggaacagc taaagccatt
     3781 cacagaaccc agaggcaaac caccaagacc aaatgtgttg gaagctgcca agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc accccaaaaa tggtcatttg cgcaagcttg
     3901 cgcatccctt gacaaaacca cttccagcgg ccacccgcac cacatgcgga aaaacgattg
     3961 ttggaatggg gagtccttca caggaaaatt ggctgatcaa gcctccaagg ccaacctaat
     4021 gtttgaagag ggaaagaata tgactccagt ctacacaggc gcacttaaag atgagttggt
     4081 aaagaccgac aaagtttatg gtactatcaa gaagaggctc ctgtggggtt cagatctggc
     4141 gaccatgata cggtgcgccc gagcttttgg aggcctcatg gatgaactca aggcgcactg
     4201 tgtcacactt cctgtcagag ttggtatgaa catgaatgag gatggcccca tcatctttga
     4261 gaagcactcc agatatagat atcactatga tgctgattat tcccggtggg actcaacaca
     4321 acaaagggat gtgctagcag cagcactaga aatcatggtt aagttctctc cagaaccaca
     4381 cctggcccag gtagttgcag aagaccttct ttcccctagc gtgatggatg taggtgactt
     4441 tcaaatatca ataagtgagg gtcttccctc tggggtacct tgtacctccc agtggaattc
     4501 catcgcccac tggctcctca ctctttgtgc actctctgaa gtcacggacc tatcccctga
     4561 catcattcag gccaactccc ttttctcctt ctatggtgat gatgagattg taagcacaga
     4621 catagagttg aacccagaga agctgacagc aaaactcaag gagtacgggc tgaaaccaac
     4681 ccgccccgac aaaactgaag gaccccttgt tatcactgaa gacctgaatg gcctgacatt
     4741 cctccggaga actgtaaccc gtgatccagc tggctggttt ggaaaattgg aacaaagttc
     4801 aattctcaga caaatgtact ggaccagggg tcccaaccat gaagatccat ttgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt gatgtccttg ctgggtgagg ctgcactcca
     4921 cggcccggca ttttatagca aaattagcaa attagtcatt gcagagttga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgaggt tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggctct ggagcccgtt gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttgggc cctgatttaa
     5341 atccctacct atcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaattct cgcggggaac gcgttcaccg ccgggaaggt catatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagcccca gccaggtcac tatgttcccc catatagtgg
     5521 tagatgttag gcaactagaa cctgtgttga ttcccttacc cgatgttagg aataattttt
     5581 atcattataa tcaatcaaat gaccccacca ttaaattgat agcaatgttg tacacaccac
     5641 ttagggctaa taatgctggg gatgatgtct tcacagtttc ttgccgagtt ctcacgaggc
     5701 catcccccga ttttgatttc atatttctag tgccacccac agttgagtca agaaccaaac
     5761 cattctctgt cccagtttta actgttgagg aaatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagtt gttcacaggt cccagcagtg actttgttgt ccaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggcacca cccaactgtc tcctgtcaat atctgtacct
     5941 tcagaggaga tgtcacccat accacaggta gtcgtaacta cacaatgaat ttggcttctc
     6001 aaaattggaa caattatgac ccaacagaag aaaccccagc ccctctagga actccagact
     6061 ttgtggggaa gattcgaggc atgctcaccc aaaccacaag ggcagatggc tcaacacgcg
     6121 gccacaaagc cacagtgtac actgggagcg ccgactttgc tccaaaactg ggtagagttc
     6181 aatttgaaac tgacacagac aatgattttg atgctaacca aaacacaaag ttcaccccag
     6241 tcggtgtcat ccaagatggt accaccaccc accgaaatga accccgacag tgggtgctcc
     6301 caagttactc aggcagaaac actcataatg tacatctagc ccctgctgta gcccccactt
     6361 ttccgggtga gcaacttctc ttcttcagat ccaccatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgtttg ctcccccagg aatgggtgca gttcttctac caagaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcacact ggcccacatg
     6601 atttggttat tccccccaat ggttatttca gatttgattc ctgggtcaac cagttctaca
     6661 cgctcgcccc catgggaaat ggaacggggc gtagacgtgc agtataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctta tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgagtt tgaaaataac agaaaattgc aacaagcatc
     6841 cttccaattt agcagcaatc tacaacaggc ttcctttcaa catgataaag aaatgctcca
     6901 agcacagatt gaggccacca aaaagctaca acaggaaatg atgaaagtta agcaggcagt
     6961 gctcctagag ggtggatttt ctgagacaga tgcagcccgc ggggcaatca acgcccccat
     7021 gacaaaagct ttggactgga gcgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ccacccctca accatcgggg gcactgccag gaagagctaa
     7141 tcttagggat gctgcccctg ctcggggttc ctccagtaaa tcttctaact cttttactgc
     7201 tacttctgtg tactcaaatc aaaccacttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc catcaactgc aaggactagg agctgggttg aggatcaaag
     7321 caggaatttg tcacctttca tgaggggggc ccataacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc actcttcgct cacattcgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt cttttcttta gtgtctttt
//