Typing tool

Complete norovirus genomes

LN854564  GI.6
 GI.P11

Length: 7,691 | 3 CDS

ORF1: 5..5371
ORF2: 5355..6977
ORF3: 6977..7606
LOCUS       LN854564                7691 bp    RNA     linear   VRL 12-JUN-2015
DEFINITION  Norovirus GI/Hu/NL/2012/GI.6/Groningen, complete genome.
ACCESSION   LN854564
VERSION     LN854564.1
KEYWORDS    complete genome.
SOURCE      Norovirus GI/Hu/NL/2012/GI.6/Groningen
  ORGANISM  Norovirus GI/Hu/NL/2012/GI.6/Groningen
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Bavelaar,H., Rahamat-Langendoen,J., Niesters,H.G.M., Zoll,J. and
            Melchers,W.J.G.
  TITLE     Whole genome sequencing of faecal samples as a tool for the
            diagnosis and genetic characterization of norovirus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7691)
  AUTHORS   Zoll,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2015) Medical Microbiology, RADBOUDUMC, PO Box
            9101, 6500 HB Nijmegen, NETHERLANDS
FEATURES             Location/Qualifiers
     source          1..7691
                     /organism="Norovirus GI/Hu/NL/2012/GI.6/Groningen"
                     /mol_type="genomic RNA"
                     /strain="GI/Hu/NL/2012/GI.6/Groningen"
                     /host="Homo sapiens"
                     /db_xref="taxon:1665645"
                     /note="genotype:GI.6"
     gene            5..5371
                     /gene="POL"
     CDS             5..5371
                     /gene="POL"
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="CRL46954.1"
                     /translation="MMMASKDVVATNVASNNNANNTSATSRFLSRFRGLGGGASPPNP
                     IKIKSTEMALGLIGKTTQGAAGANDLPPKQQRDRPPRTQEEVQYDMGWTERPMDQNVK
                     SWEELDTSTKEEILDSHKEWFDAGGLGPCTMPSTCEQAKDDSPPGEQVKWSVRDGVDL
                     GVNRLTTVSGPEWNLCPLPPIDLRNMEPASEPTIGDMIEFYEGHIYHYSIYIGQGKTV
                     GVHSPQAAFSVARVTIQPIAAWWRVCYIPQPKHRLSYDQLKELENEPWPYAAITNNCF
                     EFCCQVMNLEDTWLQRRLITSGRFHHPSQSWSQQTPEFQQDSKLELVRDAILAAVNGL
                     VSQPFKNFLGKLKPLNVLNILSNCDWTFMGVVEMVILLLELFGVFWNPPDVSNFVASL
                     LPDFHLQGPEDLARDLVPVILGGIGLAIGFTRDRVTKVMKSAVDGLRAATQLGQYGLE
                     IFSLLKKYFFGGDQTERTLKGIEAAVIDMEVLSSTSVTQLVRDKQAAKAYMNILDNEE
                     EKARKLSAKNADPHVISSTNALISRIAMARSALAKAQAEMTSRMRPVVIMMCGPPGIG
                     KTKAAEHLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMTKIQDDCNK
                     LQAIADSAPLTLNCDRIENKGMQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVY
                     CSAPEVEQIRRVSPGDTSALKDCFKPDFSHMKMELAPQGGFDNQGNTPFGKGVMKPTT
                     INRLLIQAVALTMERQDEFRLQGKMYDFDDDRVSAFTTMARDNGLGILSMASLGKKLR
                     GVTSMEGLKNALKGYKIGACTIKWQAKVYSLESDGNSVNIREEKNVLTQQQQSVCAAS
                     IALTRLRAARAVAYASCIQSAITSILQIAASALVVNRAVKRMFGTRTAALSLEGPPKE
                     HKCRVHQAKAAGKGPIGHDDVVDKYGLCETEEDEEVVHTEMPSATIEGKNKGKNKKGR
                     GRKNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDG
                     GIGETEMEIRHRVFYKSKSKKHHQEERRQLGLVTGSDIRKRKPIDWTPPKSAWADDER
                     EVDYNERINFEAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSI
                     AIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIA
                     SMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKS
                     GNTVVCAVQASEGETTLEGGDKGHYAGHEIIKHGCGPALSTKTKFWKSSPEPLPPGVY
                     EPAYLGGRDPRVSGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSSLEQVMD
                     TPVPWSYSDACQSLDKTTSSGFPHHKKKNDDWNGTAFIRELGEQAAHANNMYEQAKSM
                     KPMYTAALKDELVKPEKVYQKVKKRLLWGADLGTVIRAARAFGPFCDAIKSHTIKLPI
                     KVGMNSIEDGPLIYAEHSKYKYHFDADYTAWDSTQNRQIMTESFSIMCRLTASPELAS
                     VVAQDLLAPSEMDVGDYVIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDV
                     IQSMSYFSFYGDDEIVSTDIEFDPAKLTQVLKEYGLKPTRPDKSEGPIIVRKNVDGLV
                     FLRRTISRDAAGFQGRLDRASIERQIYWTRGPNHSDPFETLVPHQQRKVQLISLLGEA
                     SLHGEKFYRKISSKVIQEVKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVN
                     DDGV"
     gene            5355..6977
                     /gene="VP1"
     CDS             5355..6977
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="CRL46955.1"
                     /translation="MMMASKDAPTSPDGASGAGQLVPEANTAEQISMDPVAGASTAVA
                     TAGQVNMIDPWIFNNFVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYNG
                     WVGNMRVRILLAGNAFTAGKIIICCVPPGFDARILTIAQATLFPHLIADVRTLEPVEL
                     PLEDVRNVLYHNSSQPQPTMRLVAMLYTPLRTGGGSGGTDAFVVAGRVLTCPAPDFSF
                     LFLVPPSVEQKTRVFSVPNIPLKDLSNSRVPVPIQGMFMSPDVNQSVQFQNGRCQIDG
                     QLQGTTPVSLSQLCKIRGKTSSNARVLNLSEVDGTPFIPLESPAPVGFPDLGGCDWHV
                     NFTFQAQNQDPSQSVTFATNDASFVPYLGSISPHNGGDFHAGDIIGSLGWISAPSDNS
                     QLNVWTIPKYGSSLPDVTHLAPAVFPPGFGEVILYFYSTFPGSGQPSQLQVPCLLPQE
                     FITHFCNEQAPIAGEAALLHYVDPDTGRNLGEFKLYPDGFMTCVPNSVSSGPQTLPIN
                     GVFVFVSWVSRFYQLKPVGTASAARRLGLRRI"
     gene            6977..7606
                     /gene="VP2"
     CDS             6977..7606
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="CRL46956.1"
                     /translation="MAQAVIGAIAASAAGSILGAGIQAGAEAGLQAQRYQQDLQLQQN
                     SFKHDKEMLGYQVQASNALLAKNLNTRYALLQAGGLSSADAARAVAGAPVTRIVDWNG
                     TRIAAPASSATTLRSGGFMAVPIPLSSKTKQPVMSGQDNPNYAASSISRTASWVQSQN
                     SMRSVSPFHSDALRTVWVTPPGSSSTSSVQSSFYGVFNTDRLPLFANRR"
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcgactaat gttgcaagca ataacaatgc
       61 taacaacact agtgctacat ctcgattttt atcgagattt aggggtttag gtggtggcgc
      121 gagcccccct aaccccataa agattaaaag cacagaaatg gccttgggtt tgattggcaa
      181 gacaacccaa ggggcagcag gggccaatga cctgccacct aaacagcaaa gagaccgacc
      241 ccctaggacc caagaggaag ttcagtacga catgggatgg actgaacggc ctatggacca
      301 gaatgttaag tcatgggagg aacttgatac ctctaccaag gaagagatct tggacagcca
      361 caaagaatgg ttcgatgctg gcggtttggg tccatgtaca atgccctcaa cttgtgaaca
      421 ggctaaggat gatagcccgc ctggtgagca agtcaaatgg tcagtgcgtg atggagttga
      481 ccttggagtg aatcgcctca caacggtgag tggccccgag tggaatctct gtcctctacc
      541 ccccattgac ctaaggaata tggaaccagc tagcgaaccc accattggag acatgataga
      601 gttttatgaa ggtcatatct accactactc catatacata gggcagggaa agacagttgg
      661 tgtgcattcc ccacaggcgg cattctcagt ggccagagta accatccaac ccatagctgc
      721 ttggtggagg gtttgctaca taccccagcc caaacataga ctgagttatg accagctcaa
      781 ggagttggaa aatgaacctt ggccatatgc agccatcacc aacaattgtt ttgagttttg
      841 ctgtcaagtt atgaaccttg aggacacatg gttacagagg cgactaataa catcaggtag
      901 attccatcac ccttcccagt cttggtcaca acagacccct gaatttcagc aggatagcaa
      961 gctggaattg gttagagatg ccatactggc cgcggtgaat ggccttgttt cacaaccctt
     1021 taaaaatttc ttgggcaagc tcaagcccct taacgtgtta aacatcttat ctaactgtga
     1081 ttggaccttc atgggggtgg tagagatggt tatactactt cttgagctct ttggcgtgtt
     1141 ctggaatccg cccgatgtgt ctaattttgt agcatctctc ctccctgact tccacctcca
     1201 ggggccagaa gacctagccc gggatctggt gccagtcatt cttggtggca tagggttagc
     1261 cattggattt accagagata gggtcactaa agtcatgaaa agtgctgtag atgggctccg
     1321 ggccgccacg cagctagggc aatacggatt ggaaatattt tcactactca agaagtattt
     1381 ctttggtggg gatcagactg aacggaccct caaaggcatt gaagcagcag tcatagatat
     1441 ggaggttttg tcctctacat cagtaacaca actggtgaga gacaagcagg cagctaaagc
     1501 ttatatgaac atcctggata atgaagagga aaaagctaga aaactctctg ctaagaatgc
     1561 tgacccccat gtgatatcct caacaaatgc cctaatatca cgcatagcta tggcacgatc
     1621 cgctctggct aaggctcaag ctgagatgac cagccgaatg aggccagttg tcatcatgat
     1681 gtgtggacct cctggaattg gaaaaactaa ggcagcggag cacttggcaa aacgcctggc
     1741 taatgagatc aggcctggcg gcaaagtggg actggtgccg cgtgaggctg ttgaccactg
     1801 ggatggctac catggtgagg aagtgatgct atgggatgac tatggcatga caaagataca
     1861 agatgactgc aacaagctcc aggccattgc tgactctgcc ccactcactc tcaattgtga
     1921 taggattgaa aacaagggga tgcagtttgt gtcagatgca atagtcatca ccaccaatgc
     1981 cccagggcct gcccctgtgg acttcgtcaa cctcggcccc gtgtgcagac gggttgactt
     2041 cctggtctac tgttctgccc cagaagtgga gcagataagg agagtcagcc ctggtgacac
     2101 atcagcactt aaagactgct tcaaaccaga tttttcccat atgaagatgg agttggctcc
     2161 tcaagggggg tttgacaacc aagggaacac accattcggc aagggtgtta tgaaaccaac
     2221 aaccatcaat aggctcctca tacaagctgt ggctcttacc atggagagac aggatgagtt
     2281 ccggctccag gggaagatgt atgattttga tgatgatagg gtgtcagcct tcaccaccat
     2341 ggcacgcgat aatggattgg gtattctgag tatggcgagc ctgggtaaga agctgcgcgg
     2401 tgttacatca atggagggct tgaagaatgc tttgaagggg tacaaaattg gtgcgtgcac
     2461 aattaagtgg caggccaagg tatattcact ggaatcagat ggcaacagtg ttaacattag
     2521 ggaggagaag aatgttttaa ctcaacaaca gcagtcggta tgcgctgcct ccattgcact
     2581 cacccgcctg cgggccgcgc gtgcagtggc gtatgcgtca tgcatccaat cagccataac
     2641 ctccatacta caaattgctg cctcagccct agtggtcaac agagccgtga aaagaatgtt
     2701 tggcacacgc actgctgctt tgtccctaga gggtcccccc aaagaacaca agtgcagagt
     2761 ccaccaggct aaggccgcag ggaaaggacc cattggccac gatgacgtgg ttgataaata
     2821 tggactatgt gagactgagg aggacgaaga ggtagtccat actgagatgc catctgccac
     2881 catagaaggc aagaataaag ggaagaacaa gaaagggcgc ggccgaaaga ataattacaa
     2941 tgccttttcc cgtagagggc tcaatgatga agagtacgag gagtacaaga agatacggga
     3001 agagaagggt ggaaattata gcattcagga atacctagaa gatagacaaa ggtatgaaga
     3061 ggagcttgct gaggttcaag caggtggaga cggagggatc ggcgaaaccg aaatggaaat
     3121 ccgccataga gtgttctata agtccaagag caagaagcac caccaggaag agcggcgcca
     3181 actgggatta gtcacaggtt ctgacatccg gaaaaggaaa ccaattgact ggaccccccc
     3241 taagtcagca tgggcagatg atgagcgtga agtggactac aatgagagaa tcaactttga
     3301 ggcgcccccc actttgtgga gccgggtcac aaaatttgga tctgggtggg gcttttgggt
     3361 tagtcccaca gtcttcataa ccacaacgca cgttatacca accagtgcaa aagagttctt
     3421 tggtgaaccc cttaccagca tagccattca cagggccgga gaattcaccc tcttcaggtt
     3481 ttctaagaaa atcaggcccg atctcacggg catgatcctt gaggaaggct gtccagaggg
     3541 tacggtgtgc tcagtgttaa taaaaaggga ctccggtgag ctattaccat tagctgtgag
     3601 gatgggcgca atagcatcaa tgcgcataca gggtcgcctt gtccatggcc agtctggtat
     3661 gttgctcacc ggggcgaatg ctaagggcat ggaccttgga actatcccag gggattgtgg
     3721 agctccctat gtctataaga gagcaaatga ctgggtggtt tgtggtgtgc atgctgctgc
     3781 cactaaatca ggcaacacgg tagtgtgtgc cgttcaagct agtgaagggg aaaccacact
     3841 agaggggggt gacaaaggtc actatgccgg gcatgagata atcaagcatg gatgtgggcc
     3901 agccctatca accaaaacaa agttctggaa gtcgtcccct gaaccactac cccctggagt
     3961 ctatgaacct gcatacctcg gtggccggga tccaagagtg agtggtggtc cctcgctcca
     4021 acaggtgttg cgggaccagt taaagccatt tgctgagcca cgggggcgta tgccagaacc
     4081 aggtctcctg gaggccgcag ttgagactgt gacctcatca ctggagcagg ttatggatac
     4141 cccagtgcca tggagttaca gcgatgcatg tcaatcccta gataaaacta ctagctctgg
     4201 tttcccccac cacaagaaga agaatgatga ttggaacggc actgccttca tcagggaatt
     4261 gggagagcaa gcggcgcacg ccaataacat gtatgaacaa gctaagagca tgaagcccat
     4321 gtacacggcg gcgcttaagg atgagttagt gaagccagaa aaagtgtacc aaaaagtgaa
     4381 gaagcgcttg ctttgggggg cagatctagg aacagtgatc cgggccgcac gagcctttgg
     4441 cccattctgt gatgccataa agtcccacac aattaaacta cctatcaaag ttgggatgaa
     4501 ctcaatcgag gatgggccat taatttatgc agagcattca aaatataaat atcactttga
     4561 tgcagactat acagcttggg actcaacaca aaataggcaa attatgactg agtcattctc
     4621 aatcatgtgc cgattgactg cttctccaga attggcctca gtggtggcac aagatctgct
     4681 tgcaccctca gagatggacg ttggtgacta cgtcataaga gtaaaggaag gccttccatc
     4741 cggcttccca tgcacgtcac aggtcaatag cataaaccat tggttgataa ctttgtgtgc
     4801 cctctctgag gtgactggcc tgtcaccaga tgttattcag tccatgtcat acttttcctt
     4861 ctatggtgat gatgaaattg tttccactga catagaattt gacccagcaa aattgacaca
     4921 agtccttaag gagtatggcc tcaagcccac ccgccccgac aagagtgaag gtccaataat
     4981 tgtgaggaag aatgtggatg gcctagtttt cttacgccgt accatttccc gcgatgctgc
     5041 ggggttccaa gggcgactag accgagcgtc cattgaaagg cagatttatt ggaccagagg
     5101 gcccaatcac tcagacccct ttgaaacctt ggtgccccac cagcaaagaa aagtccagct
     5161 gatatcactg ttaggtgagg cttcattaca tggtgaaaag ttctacagga agatctcaag
     5221 caaagtcatc caagaggtta aaacaggggg ccttgaaatg tatgtgccag ggtggcaagc
     5281 catgttccgc tggatgcggt tccatgatct tggcttgtgg acaggagatc gcaatctcct
     5341 gcccgaattc gtaaatgatg atggcgtcta aggacgcccc aacatcccct gatggcgcca
     5401 gtggcgccgg ccagctggta ccggaggcta atacagctga gcaaatttca atggaccctg
     5461 ttgcgggtgc ttcaacagca gtcgcgacgg ctgggcaagt gaatatgatt gacccatgga
     5521 tttttaataa ctttgtccag gcacctcaag gagaattcac tatttcccct aataataccc
     5581 ccggtgatat tttgtttgat ttacaattgg gaccccacct taatccattt ttagcccatc
     5641 tctcacagat gtataatggt tgggtcggca atatgcgtgt gcgcatactg ttggccggga
     5701 atgcctttac agctggaaag ataatcattt gctgtgtccc ccctggcttt gatgctagaa
     5761 tacttacaat agctcaagca accctcttcc cacacttaat tgctgatgtt aggacccttg
     5821 agcctgtgga gcttcctttg gaggatgtgc gcaacgttct ctaccacaat agtagtcagc
     5881 cgcagccaac aatgcggctg gttgctatgt tgtacactcc cctccgcact ggtggtggtt
     5941 ccggaggcac tgatgccttt gtggtggcgg gtagggtgct tacgtgcccc gcccccgatt
     6001 ttagtttcct gtttcttgtt cctccctccg ttgaacaaaa gactagagtt ttcagtgtcc
     6061 ccaatatacc cctgaaagat ctctcaaatt ctcgtgtccc cgtacccata cagggcatgt
     6121 ttatgtcccc agatgttaat cagtcagtcc agtttcagaa tgggcgctgc cagattgatg
     6181 gtcaactcca gggcaccacc ccagtctcgc tcagccaact ctgcaagatt aggggtaaaa
     6241 cttctagtaa tgccagggtg ctcaacttaa gcgaggtaga tggcacacct tttatccccc
     6301 ttgaatcacc agcgccagtt ggttttcccg acttaggagg ttgtgactgg catgtgaatt
     6361 tcactttcca ggctcaaaac caggacccat cccaaagtgt gacctttgca actaatgatg
     6421 ccagctttgt cccttaccta ggtagcattt cccctcataa tgggggagac tttcatgcag
     6481 gcgacatcat aggtagcctt ggatggattt cagccccgtc tgacaattca caacttaatg
     6541 tttggacaat accaaagtac ggatctagtc tcccagatgt cactcatctt gctcctgctg
     6601 tgttcccccc aggctttggg gaagtgatcc tatacttcta ttctaccttc ccaggttctg
     6661 gacaacctag tcaacttcaa gtcccatgtt tgttgcccca ggagttcatc acccacttct
     6721 gtaatgaaca agctcccatc gctggggagg ctgctctcct ccactacgtg gaccctgata
     6781 cgggccggaa cttgggggag ttcaaacttt accctgatgg atttatgacc tgtgtcccta
     6841 atagtgttag cagtggccct caaaccctac ctatcaatgg agtctttgtc tttgtttcat
     6901 gggtgtccag attctatcaa ctcaagcctg tgggaacggc ctcagcggct agaaggcttg
     6961 gactgcggcg catataatgg ctcaagctgt catcggtgcc atagccgcgt ctgccgctgg
     7021 tagcatacta ggggcaggca tacaggctgg tgctgaggct ggtcttcagg ctcaacggta
     7081 ccagcaggat ctacagttgc agcaaaattc ttttaagcat gataaggaaa tgttaggcta
     7141 tcaagttcag gctagtaatg ctcttttggc taagaatctt aacactagat atgctcttct
     7201 gcaggcaggg ggcctgtcta gtgctgatgc tgctcgggca gtggctggtg ctcctgtcac
     7261 tcgtatagtg gattggaatg gcacgcgcat tgcagcgccc gcctcaagtg ccaccacact
     7321 cagatctggt ggttttatgg ccgtccctat accattgtct tcaaagacca agcaaccagt
     7381 gatgtctggg caggacaatc caaattatgc tgcttcttct atctctagaa ctgcttcatg
     7441 ggtgcaatct caaaattcta tgaggtctgt ctctcccttt cacagtgatg ctctgagaac
     7501 cgtttgggtc acaccacccg gttcatcatc aacttcatct gtgcagtcta gtttttatgg
     7561 tgtttttaat acagatagat tgcctctgtt cgcaaacaga aggtaaaatt ttgtaatagg
     7621 atgccagtgg gcaccatatt cagatttgat ttaattagat tgctttaatt aaatttggct
     7681 taattggtgt t
//