Typing tool

Complete norovirus genomes

LN854563  GI.4
 GI.P4

Length: 7,697 | 3 CDS

ORF1: 5..5362
ORF2: 5346..6980
ORF3: 6980..7606
LOCUS       LN854563                7697 bp    RNA     linear   VRL 01-OCT-2015
DEFINITION  Norovirus GI/Hu/NL/2011/GI.4/Groningen, complete genome.
ACCESSION   LN854563
VERSION     LN854563.1
KEYWORDS    complete genome.
SOURCE      Norovirus GI/Hu/NL/2011/GI.4/Groningen
  ORGANISM  Norovirus GI/Hu/NL/2011/GI.4/Groningen
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Bavelaar,H., Rahamat-Langendoen,J., Niesters,H.G.M., Zoll,J. and
            Melchers,W.J.G.
  TITLE     Whole genome sequencing of faecal samples as a tool for the
            diagnosis and genetic characterization of norovirus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7697)
  AUTHORS   Zoll,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2015) Medical Microbiology, RADBOUDUMC, PO Box
            9101, 6500 HB Nijmegen, NETHERLANDS
FEATURES             Location/Qualifiers
     source          1..7697
                     /organism="Norovirus GI/Hu/NL/2011/GI.4/Groningen"
                     /mol_type="genomic RNA"
                     /strain="GI/Hu/NL/2011/GI.4/Groningen"
                     /host="Homo sapiens"
                     /db_xref="taxon:1665644"
                     /note="genotype:GI.4"
     gene            5..5362
                     /gene="POL"
     CDS             5..5362
                     /gene="POL"
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="CRL46951.1"
                     /db_xref="UniProtKB/TrEMBL:A0A0G4PZE6"
                     /translation="MMMASKDVVAATAASAENTSDNSDSIKNRFFTRLKNLGSNNKPI
                     KIENTHMALNLISRGPSPIPQDKPPKDQRDKPPRNVAETQQAMGWIDPPMDQNLPTWE
                     ELSQTEKQEILKNNSNWFDAGGLAPASIPTGYVKNTEQQPPDHQVKWSASNGVDLGVG
                     NLTTVPGPAWNLCPMPPIDQRNNGPAKEPLIGDMIEFYEGHIYHYAIYIGQGKTVGVH
                     SPQAAFSIARITIHPIAAWWRVCYVPTPDQRLNYDQLKELENEPWPYAAVTNNCYEFC
                     CRILNLQDSWLERRLVTSGRFNHPAQDWSRDTPDFQQDSKLEIVRDAVLAAINGLVSK
                     PFKDLLNKLKPLNVLNLLSNCDWTFMGVVETIILLMELFGIFWNPPDVSSFIASLLPD
                     MHLQGPEDLAKDLIPLVLGGVGLAIGFTKDKVTKVMKSAVEGLRAATQLGQYGLEIFA
                     VLKKYFFGGDQTEKTLKDIETAVIDMEVISTTAVTQLVRDKQAARTYMNILDAEEEKA
                     RKLSVRHADPHVVSTTNALISRISLARSALAKAQAEMTNRVKPVVIMMCGPPGIGKTK
                     AAEYLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMSKIADDCNKLQA
                     IADTAPLTLNCDRIEKKGLQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVYCTA
                     PDVEQTRRTNPGDTGALKDCFKSDFSHLKMELAPQGGFDNQGNTPFGKGTMRPTTLNR
                     LLIQAVALTMERQDEFQMQGQVYDFDADRITAFTSLARANGLGLISMASLGKKLRGVD
                     SVHGLKNALSGYTITPCSIKWQARVYDIESDGTNVRIKENTSAQTQRQQSIDTAALAL
                     TRLKAARAAAYAACIQSAITTILQMAGSAIVINRAVKRMFGAHSSTIALEGPPREHRC
                     RAHLAKAAGGGPIGHDDVIDKYGLCETEEEDTSEEINVELPTATSEGKNKGKTKKGRG
                     RRANYNAFSRRGLSDEEYEEYKKIREEKNGNYSIQEYLEDRQRYEEELAEVQAGGDGG
                     IGETEMEIRHKIFYKSKKGRQNERRQLGLVTGSDIRKRKPIDWTPPKNDWADDNREVD
                     YNEKLSFEAPPTLWSRVVRFGSGWGFWVSPTVFITTTHVIPSGAREFFGEPIESIAIH
                     RAGEFTQFRFSYKVRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIASMK
                     IQGRLVHGQSGMLLTGANAKGMDLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNT
                     VVCAVQAGEGETTLEGGDKGHYAGHEIIKHSKGPALSTKTKFWRSTPEPLPPGVYEPA
                     YLGGRDPRVKGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSMLEQTMDTPI
                     PWSFSDACQSLDKTTSSGHPYHKRKNDDWNGTSFVGELGEQAAHANNMYELGKSMKPL
                     YTAALKDELVKPEKVYQKIKKRLLWGADLSTVIRAARAFGPFCDAIKPHVIKLPIKVG
                     MNSIEDGPMIYAEHAKYKNHFDADYSAWDSTQNRQIMTESFAIMCRLTASPELASVVA
                     KDLLAPSEMDVGDYIIRVKEGLPSGFPCTSQVNSINHWLITLCAMSEVTGLSPDVIQS
                     QSYFSFYGDDEIVSTDIDFDPARLTQVLKEYGLRPTRPDKSEGPIILRRQVDGLVFLR
                     RTISKDAAGFQGRLDRGSIERQLWWTRGPNHDDPSETLIPHPQRKVQLISLLGEASLH
                     GEKFYRKISSKVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVNDDG
                     V"
     gene            5346..6980
                     /gene="VP1"
     CDS             5346..6980
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="CRL46952.1"
                     /db_xref="UniProtKB/TrEMBL:A0A0G4PYH9"
                     /translation="MMMASKDATPSADGATGAGQLVPEVNTADPIPIDPVAGSSTALA
                     TAGQVNLIDPWIINNFVQAPQGEFTISPNNTPGDVLFDLQLGPHLNPFLSHLSQMYNG
                     WVGNMRVRVVLAGNAFTAGKVIICCVPPGFQSRTLSIAQATLFPHVIADVRTLDPVEV
                     PLEDVRNVLYHNNDTQPTMRLLCMLYTPLRTGGASGGTDSFVVAGRVLTCPGPDFNFL
                     FLVPPTVEQKTRPFTVPNIPLKYLSNSRIPNPIEGMSLSPDQTQNVQFQNGRCTIDGQ
                     PLGTTPVSVSQLCKFRGRITSGQRVLNLTELDGSPFMAFAAPAPAGFPDLGSCDWHIE
                     MSKIPNSSTQNNPIVVNSVKPNSQQFVPHLSSITLDDIVSSGGDYIGTIQWTSPPSDS
                     GGANTNFWKIPDYGSSLSEASQLAPAVYPPGFNEVIVYFMASIPGPNQSGSPNLVPCL
                     LPQEYITHFISEQAPIQGEAALLHYVDPDTNRNLGEFKLYPGGYLTCVPNSSSTGPQQ
                     LPLDGVFVFASWVSRFYQLKPVGTAGPARGRLGVRR"
     gene            6980..7606
                     /gene="VP2"
     CDS             6980..7606
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="CRL46953.1"
                     /db_xref="UniProtKB/TrEMBL:A0A0G4PYW3"
                     /translation="MAQAIIGAIAASAAGSALGAGIQAGAEAALQAQRYQQDLTLQQN
                     SFNHDKEMLGYQVEMSNKLLAKNLNTRYSLLQAGGLSPSDAARAVAGAPVTRLVDWGG
                     VRVAAPQSSATTLRSGNFMAVPLPAQPKQKPLASEGYSNPAYDPMQRTASWVQSQNSS
                     RNWSPYHRQALQTVWVTPPGSTSSSSVSTAPRGYFNTDRLPLFANLRR"
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcagctact gctgctagtg ctgaaaacac
       61 tagtgacaat agtgattcta taaagaaccg tttcttcaca aggttgaaga acttaggttc
      121 taacaataag cccataaaaa ttgagaacac ccacatggcc cttaacttaa ttagtagggg
      181 tccatctcca attccacaag ataaaccccc taaagaccag agggataaac ccccaaggaa
      241 tgtggctgag acccagcagg caatgggatg gatcgacccc cccatggacc agaatctacc
      301 aacctgggag gagttaagcc aaacagaaaa gcaagagata ctcaaaaaca attcaaattg
      361 gtttgatgct ggtggtttgg caccagctag catccctact ggttatgtga agaatacaga
      421 gcaacaaccc cctgaccacc aagtcaagtg gagtgccagt aatggggttg atcttggggt
      481 aggcaattta acaactgtgc caggtccagc atggaatctg tgccccatgc caccaattga
      541 ccaacgcaac aatggtccag caaaggaacc acttattggt gacatgatag aattctatga
      601 ggggcacatt taccattatg caatatacat tggccaagga aaaactgttg gggttcactc
      661 acctcaagcg gccttttcaa tagccaggat aactatacac cctatcgccg cttggtggag
      721 ggtttgttat gtgccaacac ctgatcagag gttaaattat gaccaactca aagaacttga
      781 gaatgagcca tggccatatg ctgcagttac taataattgc tatgagttct gctgcaggat
      841 tctcaatctt caggactctt ggttggaacg tcgcttggtc acatctggcc gtttcaacca
      901 cccagcacaa gactggtcca gggacacgcc tgacttccaa caagatagca agttagaaat
      961 agtcagggat gccgtgcttg ctgctatcaa tggcttggta tcaaaacctt ttaaagacct
     1021 cctaaacaaa cttaagccac tcaacgtgct caacctactc tctaactgtg attggacatt
     1081 tatgggggtg gttgagacga taatactact tatggagctg tttgggatct tctggaatcc
     1141 ccctgatgtg tccagcttta tagcctcatt attgcctgat atgcacttgc aaggaccaga
     1201 agatctggct aaagacttaa taccgttggt attgggaggt gtggggcttg caattgggtt
     1261 caccaaggac aaagttacaa aggtcatgaa gagtgctgtt gaaggactca gggcagccac
     1321 acaattaggc cagtatggcc tagagatatt tgcagtttta aagaaatatt tctttggtgg
     1381 agatcaaaca gagaagacct taaaagatat tgagacagcc gtaattgaca tggaggtcat
     1441 ctcaacaact gctgttactc aactagtcag ggacaaacag gctgcccgga cctacatgaa
     1501 catcttagat gctgaagaag agaaggcaag aaagctttca gttagacatg cagaccccca
     1561 tgttgtatcc acgaccaatg ccctgatctc acgtatttca ttggctcgct ccgcacttgc
     1621 taaggcacaa gctgagatga ctaatagggt caaaccagta gtgataatga tgtgtggtcc
     1681 cccaggtata ggcaagacaa aggcagccga gtaccttgct aagagactgg ccaacgagat
     1741 acggcctgga ggaaaagtgg gcctcgtgcc aagggaggct gtggatcatt gggatggata
     1801 tcacggtgaa gaggttatgc tatgggatga ctatggtatg tctaagatag ctgatgactg
     1861 taataaatta caggctatag ccgacacagc tccactcact ttgaattgtg accggattga
     1921 gaagaaaggg ttacaatttg tctctgatgc catagtgata acaacaaatg ccccaggacc
     1981 agccccagtc gactttgtca atcttggccc agtgtgtcgg cgggtggatt tcttggttta
     2041 ttgcactgca cccgacgttg aacaaacacg tcgcactaac cctggagaca ccggagccct
     2101 taaggattgc tttaaaagtg acttctctca tctaaaaatg gagttggctc cacagggcgg
     2161 attcgacaat caaggaaaca ctccatttgg caaagggacc atgcggccta ccacattaaa
     2221 ccgcctcctt atacaggccg tagcactaac catggagcgt caggatgagt tccagatgca
     2281 aggtcaagtg tacgattttg atgctgacag gatcactgcc tttaccagtt tagcaagagc
     2341 caatggtttg ggtctcatta gcatggcctc tctaggaaag aaattaaggg gtgtggactc
     2401 ggttcatggc ctcaagaatg cactatcagg ctataccata accccctgta gcataaagtg
     2461 gcaagctaga gtgtatgaca ttgaatcaga tggtaccaat gtacgcataa aggaaaacac
     2521 ctcagcccag acacaacgcc agcaatcaat tgacacagca gccctagcac ttaccagact
     2581 taaagcagca cgggcagcag catatgcagc ttgcatacaa agcgcaataa caactatcct
     2641 gcagatggct gggtcagcca tcgttataaa tcgtgctgtt aaaaggatgt tcggtgcaca
     2701 ctcgagcact atagctcttg aaggaccccc aagagaacat cggtgcaggg ctcacttagc
     2761 caaggctgca ggtggtggac caataggcca tgatgatgtc attgataagt atggcctatg
     2821 tgagactgaa gaagaggaca ccagtgagga gataaatgtg gagctaccca ccgccacttc
     2881 cgaaggtaaa aataaaggaa agaccaagaa aggaaggggc agaagggcca actacaatgc
     2941 tttttcacgg cgcggcctga gtgatgagga gtatgaggag tataagaaga tcagggaaga
     3001 aaagaatggc aactacagca ttcaggagta ccttgaagac aggcaacgct atgaagaaga
     3061 gctcgcagaa gtgcaagctg gtggtgatgg aggcattggt gagacagaaa tggagatccg
     3121 acataaaatc ttttacaagt ccaaaaaggg ccgccagaat gaacgccgcc aattagggct
     3181 agtcactggt agtgatatca gaaagagaaa accgattgat tggacccccc ccaaaaacga
     3241 ttgggcagat gataataggg aagtggacta caatgaaaaa ctcagttttg aagccccacc
     3301 aaccctctgg agccgggttg tgagatttgg ctctgggtgg ggcttttggg tgagcccgac
     3361 tgtttttatc accaccactc atgtcatacc atctggggcg cgtgaattct ttggggaacc
     3421 catcgagtcc attgcaatcc atcgtgctgg tgaattcaca caattcagat tttcatacaa
     3481 ggtccgcccg gatctgactg gaatggtgct ggaggaaggc tgtcctgagg gtgtcgtgtg
     3541 ttctattctc attaaacgtg actctggtga gctgctaccc cttgctgtcc gaatgggcgc
     3601 tatagcgtcc atgaagattc agggaaggct agtacatggt cagtctggga tgctgcttac
     3661 tggagctaat gctaagggga tggatttagg taccctacca ggtgattgtg gtgcccctta
     3721 tgtgtacaaa aggaacaacg actgggtggt ttgtggtgta catgcagccg ctacaaagtc
     3781 aggcaacact gtggtgtgtg ctgtccaggc tggagagggt gaaaccaccc tagagggtgg
     3841 tgacaaaggc cactatgcag gtcatgaaat aatcaaacat agtaagggcc cagctctatc
     3901 tactaaaacc aagttttgga gatcaacccc tgaaccattg ccgccaggtg tttatgaacc
     3961 agcatacctt gggggtcgtg atccaagggt aaaaggcggg ccctctctgc agcaggtctt
     4021 gcgtgatcag ctgaaaccat ttgctgagcc gcgaggtcga atgccagagc ctggtctact
     4081 tgaggcagct gttgaaactg tcacgtctat gcttgaacaa acaatggata caccaatccc
     4141 ctggtctttc tctgatgcat gtcaatcact tgacaaaacc acaagttcgg gacacccata
     4201 tcataaaagg aagaatgatg attggaatgg aacttcattt gttggagagc ttggagaaca
     4261 ggcagcacat gccaacaaca tgtacgaatt aggcaaatct atgaaaccat tatacactgc
     4321 agccctaaaa gacgagttag tcaagcccga gaaagtttat caaaagatca agaagaggct
     4381 tctctggggt gctgatctct caacagttat aagggctgcc agggcctttg gaccattttg
     4441 tgatgctata aagccccatg tcattaaact ccccattaaa gtcggtatga actccataga
     4501 ggatggccca atgatttatg cagaacatgc aaaatataag aatcattttg atgcagatta
     4561 ttcggcctgg gattccacgc aaaatagaca gattatgact gaatcctttg caatcatgtg
     4621 ccgcctcaca gcatcaccgg aattggcttc tgttgtagct aaagatctac tagcgccttc
     4681 agaaatggat gttggtgatt acatcatccg tgtaaaagaa ggcttgccat caggattccc
     4741 ttgcacatca caggtgaaca gtataaacca ctggctgatc acactgtgtg ctatgtctga
     4801 agtcacgggt ttgtcacctg atgtcataca atcccaatct tacttttctt tctatggtga
     4861 tgatgagata gtctcaacag acattgattt tgaccccgct cgcctcaccc aagtgcttaa
     4921 ggaatatggg ttgagaccca ccagaccaga caagtcagaa gggcccatca tactcagaag
     4981 acaggtggat ggtcttgttt tcttaaggag gacaatttcc aaagatgctg caggctttca
     5041 gggaaggcta gataggggct caattgaaag gcaactgtgg tggactcggg gccctaacca
     5101 tgatgatccc agtgaaactc tgattccaca cccccagagg aaagttcagc ttatatccct
     5161 tcttggtgag gcttccctcc atggtgagaa gttttacagg aaaatctcca gtaaagtcat
     5221 acaggagata aagactggtg gcttagaaat gtatgtgcca ggttggcagg ccatgttccg
     5281 ctggatgcgc ttccatgatc tcggattgtg gacaggagat cgcaatctcc tgcccgaatt
     5341 cgtaaatgat gatggcgtct aaggacgcta caccaagcgc agatggcgcc actggcgccg
     5401 gccagctggt accggaggtt aatacagctg accctatacc cattgaccct gtggctggct
     5461 cctctacagc ccttgccact gcgggtcaag ttaatttgat tgatccctgg ataatcaata
     5521 attttgtgca agcccctcag ggcgagttca caatatcccc aaataatacc cccggtgatg
     5581 tgctatttga tttgcagtta gggcctcatc tgaatccttt tctttcccat ctttctcaga
     5641 tgtacaatgg ctgggtgggc aacatgcgag tacgtgttgt tttggctggt aatgctttta
     5701 cggctgggaa ggttataatt tgttgtgttc cccctggctt tcaatctcgc accctttcca
     5761 tagctcaggc tactctattt ccccatgtta ttgctgatgt taggactctt gatcctgtag
     5821 aagtgcccct tgaagatgtt aggaatgtgt tgtatcataa taatgatacc caacctacca
     5881 tgcgcctcct ttgcatgttg tacacccctc ttcgaactgg gggggcgtct ggtgggactg
     5941 attcttttgt ggtggctggg cgtgtgctta cttgcccagg ccctgacttt aacttcttat
     6001 tcctagttcc tcctacagtc gagcaaaaga ctcgcccttt tactgtgcct aatattcctt
     6061 tgaagtatct gtctaattct aggatcccaa accctattga gggtatgtct ttgtcacctg
     6121 accagaccca aaatgttcaa ttccagaatg gtaggtgtac aattgacggt cagcccctcg
     6181 ggaccacacc tgtctcagtt agccagttat gtaagtttag gggtaggatt acatctggac
     6241 agagggtgct caatctgaca gagttagacg gttcaccttt tatggccttt gccgcccccg
     6301 cccccgcggg ctttccagat ctcgggtctt gtgattggca tattgaaatg agtaaaattc
     6361 caaactccag cacccagaat aatccaatag tagttaattc tgtcaaaccc aatagtcaac
     6421 agtttgtccc gcatttgtca agtatcaccc ttgatgatat tgtttctagt gggggtgact
     6481 atattggcac tatacaatgg acctctcctc cttctgattc cggcggagcc aacacaaatt
     6541 tttggaagat tcctgactat gggtctagcc tatcagaagc ctcacagctg gcccccgctg
     6601 tctatccacc tggcttcaat gaggtgattg tgtactttat ggcatctata cctggtccca
     6661 atcaatctgg ttcccccaat ttggtgccat gccttctccc ccaggaatat ataacacatt
     6721 ttatcagtga gcaggccccc attcagggtg aggctgcctt actccattat gtagacccag
     6781 acaccaatcg taatttgggt gagttcaagt tgtatcctgg tggttatctg acttgtgttc
     6841 ctaatagttc tagtactgga cctcaacagc ttcctcttga tggtgtgttt gtctttgctt
     6901 cttgggtttc tagattttat caattaaagc ctgtgggaac agccggaccg gctagaggta
     6961 ggcttggtgt ccgcagataa tggcccaagc cattatagga gccattgctg cctccgcggc
     7021 tggcagtgcc ctgggtgctg gcattcaggc tggtgctgaa gctgcattac aggcacagag
     7081 atatcaacaa gatttaactt tacagcagaa ttctttcaat catgataaag aaatgttagg
     7141 ttatcaggta gaaatgtcca ataagctatt agctaaaaat cttaataccc gctattctct
     7201 tctccaggcg ggtggtctct ccccctctga tgcggctagg gctgtggccg gggcccctgt
     7261 cactaggttg gttgactggg gtggagttcg tgttgcagca ccccaatcat ctgccaccac
     7321 actgagatct ggcaatttta tggcagtgcc actcccagcc cagccaaagc agaaacctct
     7381 tgctagtgag ggatattcca atccagctta tgaccctatg cagcgcacag cttcttgggt
     7441 tcaatcccaa aattccagcc ggaattggtc cccataccat aggcaagccc tccaaactgt
     7501 gtgggtgacc ccccctggtt ctacttcttc ttcttctgtt tctactgccc ctcgagggta
     7561 ttttaataca gatagattgc ctctgttcgc aaacttgagg cgctaatgtt gtaataagat
     7621 tagtgagcat cctattcaat ttttggcttc atataatttg attgtatttg gcttttaatt
     7681 ttgatttggt tgatgtt
//