Typing tool

Complete norovirus genomes

LC369241  GII.17
 GII.P17

Length: 7,554 | 3 CDS

ORF1: 5..5107
ORF2: 5088..6710
ORF3: 6710..7489
LOCUS       LC369241                7554 bp    RNA     linear   VRL 11-DEC-2020
DEFINITION  Norovirus GII NoV/Hu/JP/2015/GII.P17-GII.17/MI-92 genomic RNA,
            complete genome.
ACCESSION   LC369241
VERSION     LC369241.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Matsushima,Y., Mizukoshi,F., Sakon,N., Doan,Y.H., Ueki,Y.,
            Ogawa,Y., Motoya,T., Tsukagoshi,H., Nakamura,N., Shigemoto,N.,
            Yoshitomi,H., Okamoto-Nakagawa,R., Suzuki,R., Tsutsui,R.,
            Terasoma,F., Takahashi,T., Sadamasu,K., Shimizu,H., Okabe,N.,
            Nagasawa,K., Aso,J., Ishii,H., Kuroda,M., Ryo,A., Katayama,K. and
            Kimura,H.
  TITLE     Evolutionary Analysis of the VP1 and RNA-Dependent RNA Polymerase
            Regions of Human Norovirus GII.P17-GII.17 in 2013-2017
  JOURNAL   Front Microbiol 10, 2189 (2019)
   PUBMED   31611853
  REMARK    DOI:10.3389/fmicb.2019.02189
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7554)
  AUTHORS   Doan,Y.H., Katayama,K. and Kimura,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2018) Contact:Yen Hai Doan Tokyo Medical and
            Dental University; 1-5-45 Yushima, Bunkyo-ku, Tokyo 113-8510, Japan
FEATURES             Location/Qualifiers
     source          1..7554
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="NoV/Hu/JP/2015/GII.P17-GII.17/MI-92"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Japan:Miyagi"
                     /collection_date="2015"
                     /note="genotype: GII.P17-GII.17"
     gene            5..5107
                     /gene="POL"
     CDS             5..5107
                     /gene="POL"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="BBD04695.1"
                     /translation="MASNDASAAVAGKNNNNDKEKSSSDSLFANMSVTFKKALGARSK
                     QPPPGETKQIQKPPRPPTPELVKRIPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVVQP
                     DAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPAAI
                     SLAKIEITPLSLYWRVVYTPQYLIDPGTLKNLSGETFPYTAFDNNCYAFCCWVLDLND
                     SWLSRRMIQRTTGFFKPYQDWNRKPLPTMDEPKIKKAANAVLCALSSLFTRPIKDIIG
                     KLRPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLS
                     TKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLARE
                     LAKKVASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELADT
                     CPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDIE
                     KAKRDFPGQPDMWKDHFRPDFSHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLIAR
                     ASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSVKT
                     LDELKQAIKNISIKKCQIVYNGCTYTMESDGRGKVVVEKVQNATVQTNNELVGALHHL
                     RSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDEPEDRGG
                     CPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERN
                     GKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGL
                     VTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFWVS
                     PSLFITSTHVIPKGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGAPE
                     GTVVSILIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDLVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPIL
                     GPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTE
                     PRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKNDY
                     WSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWGSD
                     LSTMIRCARAFGGLMDEFKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRW
                     DSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWTRG
                     PNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVPRQ
                     ESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5088..6710
                     /gene="VP1"
     CDS             5088..6710
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="BBD04696.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLPTGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
                     VSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
                     DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
                     CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV
                     VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     gene            6710..7489
                     /gene="VP2"
     CDS             6710..7489
                     /gene="VP2"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="BBD04697.1"
                     /translation="MAGVFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDKEMLQAQVRATKQLQSEMIALKQGVLAAGGFSPTDAARGSIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMSSPNASQSKPAKPRSLAPSSSSSSVYSMYTQST
                     HLTSGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN      
        1 gaagatggcg tctaacgacg cttccgctgc cgttgctggc aaaaacaaca acaacgacaa
       61 ggaaaaatct tcaagtgaca gcttgtttgc taacatgtct gtcactttta agaaagccct
      121 cggggcgcgg tctaaacaac cgcccccggg agaaacaaaa caaatacaaa aaccaccaag
      181 gccaccgaca ccggaattgg tgaagagaat acctccaccc ccacccaatg gcgaggatga
      241 accagggata gtgtacaagg tgggagaggg tgtgtctggg ctgcccgacc taacaactgt
      301 ggtacaacct gacgcacaaa acacagctta tagtgttccc ccacttagcc agagagaagt
      361 cggcgaagct aaagaaccgc tgcctggctc cattctggaa atgtgggatg gtgagatcta
      421 ccactatggg ctgtatgttg agcgggggca tgtgctcgga gtacacaaac cacctgctgc
      481 aataagcctt gccaaaattg aaataacacc gctgtctctc tactggagag tggtctacac
      541 tccccagtat ttgatagatc caggaactct taagaacttg agtggagaga ctttcccata
      601 cacggccttt gacaacaact gttatgcctt ctgttgttgg gtcctagacc tcaacgactc
      661 ctggcttagc aggagaatga tccaaagaac aactggattc ttcaaacctt atcaggattg
      721 gaacagaaaa cccttaccaa ccatggatga accgaaaatc aagaaggccg cgaatgctgt
      781 cctatgcgct ctctcctcac tcttcactag acccattaag gacatcattg gaaagcttag
      841 accactgaac attcttaata tactggcaac ctgcgattgg acttttgcag gcatagtgga
      901 atccttgatc cttcttgctg aactctttgg ggtgttctgg acacccccag atgtgtctgc
      961 gatgattgct cccttactcg gtgactacga gatgcaaggc cccgaagacc tggccgtgga
     1021 acttgtgccc gtggtgatgg gaggaatagg tttggtgtta ggattcacca aagaaaagat
     1081 cggcaagatg ctttcatcag ctgcgaccac acttagggcc tgcaaggatc taggatctta
     1141 tggattggag atactcaaat tggtcatgaa gtggttcttc cccaagaagg aggaggctaa
     1201 cgaactagcc atggtgaggg ccattgagga tgcagtcctg gatttggagg caatagaaaa
     1261 caatcacatg accacccttc tcaaggataa agacagcctg gccacataca tgaggactct
     1321 tgacttggaa gaagagaaag caaggaaact gtcaaccaaa tcggcgtcac ctgacatcgt
     1381 gggtacaata aacgcattat tggctaggat agcagccgcc aggtcactgg tccacaaggc
     1441 taaggaggag ctctcgagca gacagagacc tgttgttgta atgatatcag gtagaccagg
     1501 tataggaaag acccatctgg ccagagagct agccaagaaa gttgcgtcaa cactgtcagg
     1561 cgaccaaagg attggactgg tacctagaaa tggcgtcgac cattgggacg cctacaaggg
     1621 agaaagggtg gtcctgtggg atgattatgg tatgagcaac cctatacagg acgcactgag
     1681 gctccaagaa ttggctgaca cctgtcctct gaccctaaat tgtgatagga ttgaaaacaa
     1741 aggaaaagtg ttcgacagtg atgccataat tataacaacc aaccttgcaa acccagcacc
     1801 actagactat gtcaactttg aggcctgctc tagacgcata gacttcttgg tgtatgcaga
     1861 cgcacctgac attgagaagg ctaagcgtga cttccctggc caaccagata tgtggaaaga
     1921 ccatttcaga ccagacttct cacacattaa acttcagctg gcaccacagg gaggttttga
     1981 caaaaatggc aacaccccac atggcaaagg tgtggtgaag tccctgacga ttggttctct
     2041 gatcgccagg gcctccggct tgctccacga gagaatggat gaattcgagc tccaaggctc
     2101 tgacctacca accttcaatt ttgaccgcaa caaagtcgcc gccttcagac aattagcagc
     2161 tgaaaacaaa tatggtctta tggacacatt gagggtcggc aaccaactga aaagtgttaa
     2221 gaccctggat gagctgaagc aggccataaa gaacatcagt atcaagaagt gtcagatagt
     2281 gtataatgga tgcacctata ccatggaatc tgatgggagg ggcaaggttg tggttgaaaa
     2341 ggtacaaaac gcaacagttc aaaccaacaa tgaacttgta ggggcgctcc accacctgag
     2401 atctgcaagg ataagatact atgttaaatg tttccaagaa gccatttact ctctactcca
     2461 aattgctggt gcagccttcg tcacctcacg catcgtgagg cgcatgaaca tatcaaacct
     2521 ctggtcgaag ccacccatcg aggagggtga tgagcctgaa gacagaggag gatgccccaa
     2581 gcccagggat gaagatgacc tcactattga ctctagagac attaaagtgg aagggaagaa
     2641 gggcaagaac aagtctggcc ggggcaagaa acacacagcc ttctcttcca agggcctcag
     2701 tgatgaagag tacgatgagt acaagagaat cagagaggag aggaatggca aatactcaat
     2761 agaggaatac ctccaagata gggacagata ctatgaagag cttgccattg ctaaggctac
     2821 tgaggaggac ttctgtgagg aggaggagat caaaatccgc cagagaatct tccgacccac
     2881 caggaagcag cggaaagagg aaagggccac gcttgggctt gtcacaggat cggaaatcag
     2941 aaagaggaat ccagatgact ttaaaccaaa aggaaaattg tgggctgatg acaacaggag
     3001 cgtggattac aatgagagga tagattttga ggctcccccg agtgtttggt ctaggatagt
     3061 caactttggc acaggctggg gattctgggt ttctccaagt ctctttataa cttcaacaca
     3121 cgtcatacca aaaggaatca ctgaggcctt tggagtgccc ataaaccaaa tccaaattca
     3181 caaatctgga gaattttgcc gcttgcggtt tccaaagcca attagaccag acgtgagtgg
     3241 gatgatcttg gaagagggcg cccctgaagg cactgttgtg tctattctca tcaaaaggac
     3301 aacaggggag ctgatgcctc ttgcagtcag aatggggact catgccacaa tgaaaatcca
     3361 aggtagaacg gtgggtggtc agatgggtat gcttctcact ggctcaaatg ctaaaagcat
     3421 ggatctaggc acaacgccag gtgactgcgg atgtccatac atatacaaaa ggggcaatga
     3481 ccttgtggtc attggggtgc acactgcagc agctcgtgga ggcaacacgg tcatatgtgc
     3541 cacacaggga agtgaaggtg aagccactct tgaaggaggt gacaacaagg gtacctattg
     3601 tggagccccc attttgggac ctggcaatgc accaaaattg agcacaaaga caaaattctg
     3661 gagatcctct aacgcaccgc ttcccccagg tacttatgaa ccagcatacc ttggtgggag
     3721 agacccgcgc gtgaagggag gcccatctct gcaacaagtt atgagagacc aacttaaacc
     3781 tttcacagag cccagaggga agccaccaaa cccaaatgtc ttagagtcag caaagaagac
     3841 tatcatcaat gttctggaac aaaccattga cccccctcaa aagtggtcat atgcccaagc
     3901 ttgtgcatcc ctcgacaaga caacctccag tggatacccg caccacgtcc ggaagaatga
     3961 ctattggagt ggtgaatcct tcacaggaaa acttgcagat caggcttcaa aagcaaatct
     4021 catgtatgag gaaggcaagc acatgcaacc agtttacacc gcagcactca aagacgagct
     4081 cgtgaaaact gacaaaattt atggcaaaat taagaaaaga ctcctgtggg gttctgacct
     4141 ctccacaatg attcgatgcg ccagagcatt tggtggtctc atggatgaat tcaaagcaaa
     4201 ttgtattaca ctccctatca gagttggtat gaatatgaat gaagatggtc ccataatatt
     4261 tgagaaacac tccaggtaca ggtaccacta tgatgctgat tactcccgct gggactccac
     4321 acaacagcgg gcagtgctgg aagcggcact tgaaatcatg gtgagatttt ctgctgagcc
     4381 acagctggca caaatagtgg cagaggacct gctgtcacca agtgtggttg atgtgggcga
     4441 tttcaaaatc gctatcaatg aaggcctacc atctggcgtg ccttgcacct cacaatggaa
     4501 ttctattgcc cactggttac ttaccttgtg tgccctttct gaagtgacag gattaggtcc
     4561 tgacatcata caagctaact ccatgtactc tttctatggt gatgatgaga ttgtgagcac
     4621 agacataaaa ttggacccag agaaattgac cgcaaagctc aaagaatatg gccttaaacc
     4681 cactcggccc gacaaaactg aggggccgtt ggtgattagt gaggacctga atgggttgac
     4741 tttcctccgc cgaacagtca cccgtgatcc agcaggttgg tttggaaagt tggaccaaaa
     4801 ctccatcctc aggcagttgt actggacaag aggacccaac catgaagacc ccagtgagac
     4861 catgatacca cacgcacaaa gacctgtgca gctcatggca ctactaggag aatcctccct
     4921 acatggaccc tcattttaca gcaaggttag caaattagtc atatctgaac ttaaagaggg
     4981 aggaatggat ttttatgtgc ctagacaaga gtcaatgttc agatggatga ggttctcaga
     5041 tctaagcaca tgggagggcg atcgcaatct ggctcccagt tttgtgaatg aagatggcgt
     5101 cgaatgacgc cgctccatct aatgatggtg ctgctggtct cgtaccagag ggcaacaacg
     5161 agacccttcc cctagaacca gttgcgggcg cagctatagc cgcacccgtc actggccaaa
     5221 ataatataat tgacccctgg attagaacaa attttgtgca agcaccaaat ggagagttca
     5281 cagtgtcacc cagaaactct cctggagaaa ttttattaaa tttagagttg ggccctgatt
     5341 tgaaccctta tttggctcat ttgtcaagga tgtacaatgg gtatgctggt ggagtggaag
     5401 ttcaggttct cctggcaggg aacgcgttca ctgccggaaa gatcctcttc gccgccgtcc
     5461 cgccaaattt cccagtggaa ttcttaagcc cagcccagat cacaatgctc ccacatttaa
     5521 tagtagatgt taggactctt gaaccaatta tgatcccact ccctgatgtt aggaatacat
     5581 tcttccatta tagtaaccag cctaacagcc gcatgagatt agtggctatg ctctataccc
     5641 cactcagatc taatggctca ggtgatgatg tctttactgt ctcttgcagg gttttgacta
     5701 ggcctactcc tgattttgag ttcacttatt tagtgccacc ttctgttgaa tctaaaacta
     5761 agcctttttc cttacctatt ttaacccttt ctgagctcac aaattcgagg tttccagtcc
     5821 ccatcgattc gcttttcacc gcccagaata atgtgttgca ggtgcagtgt caaaatggca
     5881 ggtgtacact tgatggtgag ttacaaggca caacccagtt gctcccaact ggcatctgtg
     5941 cattcagagg acgggtgaca gcacaaatta accaacgtga caggtggcac atgcaactgc
     6001 aaaacctcaa tggtacaaca tatgacccaa ctgatgatgt gccagccccg ctgggtacac
     6061 ctgacttcaa gggcgtcgtg tttgggatgg taagccaaag aaatgtgggt aatgatgcgc
     6121 ctggctcaac cagagcccaa caggcgtggg tttcaaccta tagcccccaa tttgtcccca
     6181 aattaggttc tgtcaatctt agaattagtg ataatgatga tttccaattc cagccgacaa
     6241 aattcacacc agtgggcgtc aatgatgacg atgatggcca cccgttcaga caatgggaac
     6301 taccaaacta ttcaggggag cttaccttga atatgaatct tgccccccca gttgctccaa
     6361 attttcctgg tgaacaattg ttattcttca gatctttcgt gccatgctca ggaggttaca
     6421 accaaggtat tatagattgt cttattcccc aagaatggat ccaacacttc tatcaggaat
     6481 cagcaccctc ccagtcagac gtggccctaa tcaggtatgt caaccccgat acgggacgta
     6541 cactgtttga agcaaaattg cacagatctg gttacatcac tgtggctcac tctggagact
     6601 atcctcttgt tgttccggct aatggacact ttagatttga ttcttgggta aatcagtttt
     6661 actcactcgc cccaatggga actgggaatg ggcgaaggag ggctcagtaa tggctggggt
     6721 tttcattgca ggattggcag gcgacatgct cacgtcatct gtgggctccc ttgtgaacgc
     6781 aggggcaaac gccatcaacc aaaagataga ctttgaaaac aacaaacaac tccagtctgc
     6841 ttcctttcag catgataaag agatgctcca agcgcaggtg agggcaacca agcagctgca
     6901 atctgaaatg atagccctaa aacagggggt tttggccgca ggcggctttt cccccactga
     6961 tgcagcaagg ggatccattg gtgcacccat gacaaaggtg cttgactggt ctggcactcg
     7021 atactgggcg cccaattcca caaagacaac tggctattcg ggacaattca cctcttcacc
     7081 tgtgcatatg tctagcccaa atgcttcaca atcaaaacct gcaaagccta ggtctctagc
     7141 tccttcctct tcttctagca gtgtctatag tatgtatact caatctactc atttaacatc
     7201 tggctcttct agtaatgctt cttctgcctc cacaaaattg acaaatttaa gctctggctc
     7261 ctctcaaaac agaacagcag agtgggtaaa tcaacagaga agtcttagcc ctttcatgag
     7321 tggcgcactt aacatctcac atgtcacgcc accctcaagt agggcttcca gttctgggac
     7381 ggtctcgacc gtgcccaagg aagttttgga ctcctggacg tctgcgttta acacacacag
     7441 acagccgctc ttcgcacacc tcagagtgag gggggagtca cgtgtttagt gaaaagaaat
     7501 aattggctat aatttgattt ctttctaaat tcggctaatt tgtgtctttt aaaa
//