Typing tool

Complete norovirus genomes

LC342058  GI.6
 GI.PNA4

Length: 7,685 | 3 CDS

ORF1: 1..5358
ORF2: 5342..6964
ORF3: 6964..7593
LOCUS       LC342058                7685 bp    RNA     linear   VRL 02-APR-2019
DEFINITION  Norovirus GI Hu/JP/1998/GI.PNAd-GI.6/No24-Saitama-98-26 genomic
            RNA, complete genome.
ACCESSION   LC342058
VERSION     LC342058.1
KEYWORDS    .
SOURCE      Norovirus GI
  ORGANISM  Norovirus GI
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sano,D., Utagawa,E. and Katayama,K.
  TITLE     Identification of novel norovirus polymerase genotypes from human
            fecal samples collected before year 2000
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7685)
  AUTHORS   Utagawa,E., Katayama,K. and Doan,H.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-DEC-2017) Contact:Etsuko Utagawa Kitasato University,
            Kitasato Institute for Life Sciences, Laboratory of Viral Infection
            I; 5-9-1 Shirokane, Minato-ku, Tokyo 108-8641, Japan
FEATURES             Location/Qualifiers
     source          1..7685
                     /organism="Norovirus GI"
                     /mol_type="genomic RNA"
                     /strain="Hu/JP/1998/GI.PNAd-GI.6/No24-Saitama-98-26"
                     /host="Homo sapiens"
                     /db_xref="taxon:122928"
                     /country="Japan:Saitama"
                     /collection_date="1998"
                     /note="genotype: GI"
     CDS             1..5358
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BBB94172.1"
                     /translation="MMASKDVVAATAASASNASDNSTTIKDRLMAKLKNIGTNNKPIK
                     IENTHMALGLIRGSSPTPLKESPKQQRERAPRSVAETQQAMGWVEQPVDQNLPTWEEL
                     SESEKRDILAKNERWFDAGGLGPATLPDSYERTSQSDSHEHQVRWDANTGVDLGIRGL
                     TSVDGPAWNMCPMPPMDQRNSGPAKEPIIGDMLEFHEGHIYHYAIYIGQGKTIGVHSP
                     RAAFSIPRITIHPIAAWWRVCYTPSADQRLTYDQLRELENEPWPYAAVTNNCYDFCCH
                     VMGVQDTWLERRLITSGRFNHPTQDWSKETPDFQQDSKLEIVRDAVLAAINGLVSKPF
                     KNLLNKLKPLNVLNLLSNCDWTFMGVVETIILLMELFGVFWDPPDVSGFIASLLPDMH
                     LQGPEDLARDLIPLILGGIGLAIGFTKDKVTKVMKSAVEGLRAATQLGQYGLEIFAVI
                     KKYFFGGDQTEKTLKDIEAAVIDMEVISTTAITQLVRDKQSARTYMAILDAEEEKARR
                     LSVKHADPHVVSTTNALISRISLARSALAKAQAEMTNRVKPVVIMMCGPPGIGKTKAA
                     EYLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMSKIAEDCNKLQAIA
                     DTAPLTLNCDRIEKKGLQFVSDAIIITTNAPGPAPVDFVNLGPVCRRVDFLVYCTAPE
                     VEQVRRTSPGDTGALKDCFKSDFSHLKMDLAPQGGFDNQGNTPFGKGTMRPTTLNRLL
                     IQAVALTMERQDEFQMQGPTYDFDADRVSAFTSLARANGLGLVGMAMLGKKLRNVDSV
                     HGLKNALAGYTITPCSIKWQARIYDIESDGTTVTIKENATAQTQRQHAIDTAVLALTR
                     LRAARAMAYASCLQSAVTTILQMAGSALVINRAVKRMFGTHTGTITLEGPAREHRCRA
                     HVAKANGGGPIGHDDVIDKYGLCETEEDDEGQDIKAVIPSAAPEGKNKGKTKKGRGRR
                     TNYNAFSRRGLSDEEYEEYKKIREEKNGNYSIQEYLEDRQRYEEEMAEVQAGGDGGIG
                     ETEMEIRHRVFYKSKSKKNRQEERHQLGLVTGSDIRKRKPIDWTPPKNEWADDDREVD
                     YNEKISFEAPPTLWSRVVKFGSGWGFWVSPTVFITTTHVIPSNVREFFGEPIDTIAIH
                     RAGEFTQLRFSRKVRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIASMK
                     IQGRLVHGQSGMLLTGANAKGMDLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNT
                     VVCAVQAGEGETTLEGGDKGHYAGHEIVKHSNGPALSSKTKFWRSTTEPLPPGVYEPA
                     YLGGRDPRVKGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSMLEQTMDTPV
                     PWTYADACQSLDKTTSSGHPYHKRKNDDWNGTTFVGELGEQAAHANNMYEQGKSMKPL
                     YTAALKDELVKPEKVYQKIKKRLLWGADLSTVIRAARAFGPFCDAIKSHVIKLPIKVG
                     MNSIEDGPLIYAEHSRYKNHFDADYSAWDSTQNRQIMTESFSIMCRLTASPELASVVA
                     KDLLAPSEMDVGDYIIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDVIQS
                     QSYFSFYGDDEIVSTDIDFDPARLTQVLKEYGLRPTRPDKSEGPIIMRRQIDGLVFLR
                     RTISKDAAGFQGRLDRASIERQLWWTRGPNHDDPSETLIPHPQRKVQLISLLGEASLH
                     GEKFYRKIASRVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVNDDG
                     V"
     gene            5342..6964
                     /gene="VP1"
     CDS             5342..6964
                     /gene="VP1"
                     /codon_start=1
                     /product="viral protein 1"
                     /protein_id="BBB94173.1"
                     /translation="MMMASKDAPTSPDGASGAGQLVPEANTAEQISMDPVAGASTAVA
                     TAGQVNMIDPWIFNNFVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYNG
                     WVGNMRVRILLAGNAFTAGKIIICCVPPGFDARILTIAQATLFPHLIADVRTLEPVEL
                     PLEDVRNVLFHNSSQPQPTMRLVAMLYTPLRTGGGSGGTDAFVVAGRVLTCPAPDFSF
                     LFLVPPSVEQKTRVFSVPNVPLKDLSNSRVPVPIQGMFMSPDVNQSVQFQNGRCQIDG
                     QLQGTTPVSLSQLCKIRGKTSSNARVLNLSEVDGSPFIPLESPAPVGFPDLGGCDWHV
                     NFTFQAQGQDPSQSVTFATNDASFVPYLGSISPHNGGDFHSGDIIGSLGWISAPSDSS
                     QLNVWTIPKYGSSLPDVTHLAPAVFPPGFGEVILYFYSTFPGSGQPGQLQVPCLLPQE
                     FITHFCNEQAPIAGEAALLHYVDPDTGRNLGEFKLYPDGFMTCVPNGVSSGPQTLPIN
                     GVFVFVSWVSRFYQLKPVGTASVARRLGLRRI"
     gene            6964..7593
                     /gene="VP2"
     CDS             6964..7593
                     /gene="VP2"
                     /codon_start=1
                     /product="viral protein 2"
                     /protein_id="BBB94174.1"
                     /translation="MAQAVIGAIAASAAGSILGAGIQAGAEAGLQAQRYQQDLQLQQN
                     SFKHDREMLGYQVQASNALLAKNLNTRYALLQAGGLSSADAARAVAGAPVTRIVDWNG
                     TRIAAPTSSATTLRSGGFMAVPIPLSSKAKQPVMSGQDNPNYAASSISRTASWVQSQN
                     SIRSVSPFHSDALRTVWVTPPGSSSTSSVQSSFYGVFNTDRLPLFANRK"
ORIGIN      
        1 atgatggcgt cgaaagacgt cgttgcagct actgctgcta gcgcttccaa cgctagtgac
       61 aatagtacta caattaaaga tcgccttatg gcgaaactta agaatatagg cactaacaac
      121 aagcctataa aaattgaaaa cacacacatg gcccttgggc tcatcagggg tagttcacca
      181 acccccctga aagagtcccc caaacaacag agggagcggg ctccaaggag tgtggctgag
      241 acccagcagg cgatgggctg ggtggagcag ccagtggatc aaaacttgcc aacgtgggag
      301 gagttgagtg aatcagagaa gcgtgacatc ttggctaaga atgagagatg gtttgacgct
      361 ggtggcctcg gccccgccac tctccctgac tcatacgaac gtacctcaca aagtgattca
      421 catgaacatc aggtcagatg ggacgccaac acaggtgtgg accttggtat cagaggtttg
      481 acatcggttg acggaccggc gtggaacatg tgcccgatgc cccctatgga ccagcgtaac
      541 agcgggcctg ctaaggaacc aatcataggt gatatgttgg agttccatga gggacacatc
      601 tatcactatg ccatttatat tggccaagga aagactattg gcgtgcactc accacgagcg
      661 gctttctcaa ttccaagaat aaccatccat cctattgcag cttggtggag ggtgtgttac
      721 actccaagcg cagaccaacg gctcacatac gatcagctaa gagaattgga aaatgagccg
      781 tggccttatg ctgctgtgac taacaattgc tatgacttct gttgccatgt tatgggggtg
      841 caggacacct ggctagaacg gcggcttatc acatctggcc gcttcaacca ccccacccaa
      901 gattggtcta aggagactcc agacttccag caagatagca aactggagat agtcagggac
      961 gccgttcttg ccgccattaa cgggcttgtc tcaaaaccat tcaagaatct cctcaacaag
     1021 ctgaagcccc ttaacgtcct taacttgttg tcaaactgtg attggacctt catgggggtc
     1081 gttgaaacca taatactcct gatggaacta tttggggtgt tttgggatcc ccctgatgta
     1141 tcgggtttca tcgcttcact tttacctgat atgcacttgc agggtcctga agacctggct
     1201 agggatctga taccattgat acttggggga attgggcttg caattgggtt caccaaagac
     1261 aaagtcacca aggtcatgaa gagtgcagtg gagggcctcc gtgcagccac ccaacttggt
     1321 cagtatggct tggagatctt tgcagtcatc aagaaatact tctttggtgg agaccaaaca
     1381 gaaaagacac tcaaggatat agaggccgct gtcatagaca tggaggttat ctcgacgact
     1441 gccataaccc aactggttag ggataagcag tctgcacgca catacatggc aatcctcgat
     1501 gctgaggaag agaaagctag aaggttatca gtaaagcatg ctgaccccca cgttgtatca
     1561 accacaaacg ccctcatctc acggatatca ttggctcggt ccgcgctagc taaggcgcag
     1621 gcagaaatga ctaacagggt gaaacctgtc gtcataatga tgtgtggccc accaggaatt
     1681 ggcaagacca aggcagcaga atatttggcc aagcggctag ctaatgaaat aagaccgggt
     1741 ggcaaggtcg ggctggtccc acgtgaggct gtggaccact gggacggata ccatggcgag
     1801 gaagtgatgc tgtgggatga ttatggtatg tcaaaaattg cggaggactg caacaaacta
     1861 caggctattg cagacacagc ccccttgacc ctaaattgtg acagaattga aaagaaggga
     1921 ctccagtttg tgtctgatgc cataatcata actacaaatg cccccggccc tgcgcctgtt
     1981 gactttgtga accttggccc cgtttgtcgg cgtgtggatt tcctcgtcta ctgcacagct
     2041 ccagaggtcg agcaggtccg gcgcaccagc cctggggata caggagctct taaggattgt
     2101 tttaagagtg atttctccca tctaaaaatg gaccttgcgc cccaaggtgg atttgataac
     2161 cagggtaata cgccttttgg caagggcacg atgcggccca ccacattaaa ccgactacta
     2221 atacaggcag tggccctcac catggagcgg caagatgaat tccagatgca aggcccaact
     2281 tatgactttg atgctgatag agtgtcagct ttcaccagtc tcgcccgtgc aaatggcttg
     2341 ggccttgttg gcatggcaat gctggggaag aagctgagaa acgtggactc agtccatggc
     2401 ctcaagaatg cactcgctgg gtacactata accccatgca gcataaaatg gcaggcaagg
     2461 atctatgaca tcgagtctga tggcaccaca gtcactatca aggaaaatgc tactgctcaa
     2521 acccagcgcc agcacgcaat tgacacagcc gtgttggccc tcacccgcct gagagctgct
     2581 agggctatgg cgtatgcatc ctgtctgcaa agtgctgtta caactatatt gcaaatggcg
     2641 ggttcagcac tagtcataaa tcgtgccgta aaacgcatgt ttggcacgca tactggtacc
     2701 ataacactag aaggtcctgc ccgggaacac cgctgcaggg cccacgtagc caaggctaac
     2761 ggaggtggcc caattggaca cgatgatgtc atagacaaat atggcctttg tgagacagag
     2821 gaagacgacg aaggccaaga cataaaagct gtcattccct ctgctgcccc cgaaggtaag
     2881 aataagggaa aaaccaagaa ggggaggggc agacgcacca actacaatgc attctcacga
     2941 agggggctca gtgatgaaga gtatgaggag tataagaaaa taagagaaga aaagaatggc
     3001 aactatagca tacaagagta tcttgaagac aggcaacgct atgaagaaga gatggctgaa
     3061 gtccaggctg gtggtgacgg cggcattggc gaaactgaga tggaaatccg tcatagagtc
     3121 ttctataaat ccaagagcaa aaagaaccgc caagaagaac gccaccaatt gggccttgta
     3181 actggtagcg atatcaggaa gaggaagcca attgattgga ccccccctaa gaatgagtgg
     3241 gctgatgatg atagggaagt ggattataat gaaaagatca gttttgaagc cccaccaacc
     3301 ctctggagcc gtgtggtaaa atttggttct ggatggggct tttgggttag ccctacagtt
     3361 ttcataacta ccacacatgt catcccttca aatgttaggg aattctttgg tgagccaatt
     3421 gataccattg ccatccatcg cgcaggtgaa ttcacgcagc ttagattctc caggaaggta
     3481 cgacctgact taaccgggat ggtcttagaa gagggttgcc ctgaaggagt tgtctgttcc
     3541 atcttaataa aaagagactc cggtgagctc cttccccttg ctgttcgtat gggtgctata
     3601 gcatcaatga agattcaagg gcgactggtt catggccaat cagggatgtt actaactgga
     3661 gccaatgcca aagggatgga tctaggaacc ctgcccggag attgcggtgc cccatacgtc
     3721 tacaaaagga acaatgactg ggttgtgtgt ggggtgcatg ctgcggcaac aaagtcaggg
     3781 aacaccgtgg tgtgtgctgt ccaagcaggg gaaggagaga ctactctaga gggtggtgat
     3841 aaagggcatt atgctggcca tgagatagtc aagcacagca acgggcctgc tctatccagc
     3901 aagactaagt tttggagatc gacaactgaa ccactcccac ctggggtgta tgagccagca
     3961 tatcttggag gtcgcgaccc tagggtaaag ggcggtcctt cactccaaca agtcctacgg
     4021 gatcaactca aaccattcgc tgagccccgt ggacgcatgc ctgagcctgg tttgctggaa
     4081 gcggccgttg agactgttac atcaatgtta gaacagacta tggacacgcc ggtcccatgg
     4141 acatatgctg atgcttgcca gtcactagac aaaactacta gttcaggaca tccatatcac
     4201 aagaggaaga atgatgattg gaatggcacc acctttgtag gggagctggg cgaacaggcc
     4261 gcccacgcca acaacatgta tgagcagggg aagtccatga agccactcta cacggcagca
     4321 ttgaaggatg agctagttaa gcctgagaag gtctatcaga agattaagaa gcgactccta
     4381 tggggtgctg acttatccac agtgattagg gcggcgagag cttttggccc cttttgtgat
     4441 gccataaaat cccatgtcat caagctccct attaaggttg gcatgaactc tattgaggat
     4501 ggccccctga tttatgctga gcattcaaga tataaaaacc actttgatgc tgactattcg
     4561 gcctgggatt ccactcaaaa tagacaaatc atgactgagt ccttctctat aatgtgccgg
     4621 ctcaccgcat cacccgagtt ggcgtccgta gtggctaagg acctcctcgc tccttccgaa
     4681 atggatgtgg gtgactacat aattagagtt aaagaagggc tcccctcagg attcccatgc
     4741 acatcacaag ttaacagtat caaccattgg ctcattactc tctgtgcact ctcagaagta
     4801 actggtcttt cccctgatgt aatccagtca caatcctatt tctcatttta tggggatgat
     4861 gaaattgtat caactgatat agactttgat ccagcccgat taacccaggt gctcaaagag
     4921 tatggacttc ggcccacgcg cccagacaag agcgagggtc ccataataat gaggagacag
     4981 atagatggtc tggtattcct taggaggacg atttccaagg atgctgcagg gtttcagggg
     5041 cgtctggata gagcctccat tgaaagacag ctctggtgga cacgtggccc gaatcatgat
     5101 gaccctagtg agaccctaat accacaccca cagaggaaag tacaactcat ctcactcctt
     5161 ggtgaagctt cactccatgg ggaaaagttc tatagaaaga tagccagcag agtcattcaa
     5221 gaaattaaga cggggggctt ggaaatgtat gtgccaggtt ggcaggccat gttccgctgg
     5281 atgcgtttcc atgaccttgg gctttggaca ggggatcgca atctgctgcc cgaattcgtg
     5341 aatgatgatg gcgtctaagg acgccccaac atcccctgat ggcgctagtg gcgccggcca
     5401 gctggtaccg gaggctaata cagctgagca aatttcaatg gaccctgttg cgggtgcttc
     5461 aacagcagtc gcaacggctg gacaagttaa tatgattgac ccatggattt ttaataactt
     5521 tgtccaggca ccccaaggag aattcactat ttcccctaat aatacccccg gtgatatctt
     5581 gtttgatcta caattaggac cccaccttaa cccatttttg gctcatcttt cgcagatgta
     5641 caatggatgg gttggcaata tgcgtgtacg catattgctg gcagggaatg cttttacagc
     5701 tggaaagata attatctgct gtgttccccc tggttttgat gctagaatac tcacaattgc
     5761 tcaggcaact cttttcccac acctgatcgc tgatgttagg actcttgagc ccgtggaact
     5821 tcctctggag gacgtgcgca acgttctctt tcacaatagc agccagccgc aaccaacaat
     5881 gcgattggtg gctatgttgt acaccccact ccgcacgggc ggtggctctg gaggcactga
     5941 cgcctttgtg gtggcaggta gggtacttac gtgccctgcc cctgatttta gctttttgtt
     6001 tcttgttccc ccttctgtcg agcaaaagac cagggtattc agtgttccta atgtacctct
     6061 gaaagacctt tcaaattctc gtgtccctgt gcctatacag ggtatgttta tgtccccaga
     6121 tgtcaaccag tcagtccagt ttcagaatgg gcgctgtcag attgatggcc agctccaggg
     6181 caccacccct gtctcgctca gccagctttg caagatcagg ggtaagacct cgagcaatgc
     6241 cagagtgctt aatctcagtg aggtagatgg ttcacctttc attcccctcg aatcgccagc
     6301 accagttggc tttcccgatc tggggggctg cgactggcat gtgaatttta ctttccaggc
     6361 tcagggccag gacccatctc aaagtgtgac ctttgcaacc aatgatgcta gctttgttcc
     6421 atacctaggc agtatctctc cccataacgg gggagatttt cattcaggtg acatcatagg
     6481 tagccttggc tggatttctg ccccgtccga cagttcccaa ctcaatgtct ggacaatacc
     6541 gaagtacggt tccagcctcc cagatgtaac ccaccttgca cctgctgtgt ttcccccagg
     6601 ttttggggag gttatcttgt acttctactc cacttttcca ggttctggcc aaccagggca
     6661 actccaagtc ccatgtctat tacctcaaga gtttatcact cacttttgca atgaacaggc
     6721 ccccattgct ggggaggctg ccctcctcca ttatgtggat cctgatacag ggcgaaactt
     6781 gggggagttc aagctttacc ccgatggatt catgacttgt gtccctaatg gtgttagtag
     6841 tggccctcaa accctcccca tcaatggagt ctttgtcttt gtttcatggg tgtctagatt
     6901 ctatcaactt aagcctgtgg gaacggcctc agtggccaga aggcttggac tacggcgcat
     6961 ataatggctc aagctgtcat cggagccatt gccgcctctg ccgccggcag catactcggg
     7021 gcaggcatac aggctggcgc tgaggccggc ctccaggccc aacgatacca acaggaccta
     7081 caattgcagc aaaattcttt taagcatgat agggaaatgc taggttacca ggtccaggct
     7141 agtaatgctc ttctggctaa gaatcttaac actagatatg cccttctgca ggcagggggc
     7201 ctgtctagtg ctgatgctgc tcgggcagta gctggtgctc ctgtcacccg tatagtggac
     7261 tggaatggca cacggattgc agcgccaact tcaagtgcca caacattaag atctggtggt
     7321 ttcatggccg tccctatacc attatcttca aaggctaagc aaccagtgat gtctgggcag
     7381 gataatccaa attatgctgc ttcttctatc tctagaacag cctcatgggt gcaatctcag
     7441 aattctataa gatctgtctc tcccttccac agtgatgctc taaggactgt gtgggtcaca
     7501 ccaccaggtt catcttccac ttcatctgtg caatctagct tttatggtgt ttttaataca
     7561 gataggttac ctctgttcgc aaacagaaag tgaggttttt gtaataagat gccagtgggc
     7621 accatattca aatttaattt aattaggttg attaattaag atttggctta attggtgtta
     7681 aaaaa
//