Typing tool

Complete norovirus genomes

LC209480  GII.2
 GII.P16

Length: 7,533 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6710
ORF3: 6710..7489
LOCUS       LC209480                7533 bp    RNA     linear   VRL 14-DEC-2017
DEFINITION  Norovirus Hu/GII/JP/2010/GII.P16_GII.2/Ehime-44 RNA, complete
            genome.
ACCESSION   LC209480
VERSION     LC209480.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/JP/2010/GII.P16_GII.2/Ehime-44
  ORGANISM  Norovirus Hu/GII/JP/2010/GII.P16_GII.2/Ehime-44
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Mizukoshi,F., Nagasawa,K., Doan,Y.H., Haga,K., Yoshizumi,S.,
            Ueki,Y., Shinohara,M., Ishikawa,M., Sakon,N., Shigemoto,N.,
            Okamoto-Nakagawa,R., Ochi,A., Murakami,K., Ryo,A., Suzuki,Y.,
            Katayama,K. and Kimura,H.
  TITLE     Molecular Evolution of the RNA-Dependent RNA Polymerase and Capsid
            Genes of Human Norovirus Genotype GII.2 in Japan during 2004-2015
  JOURNAL   Front Microbiol 8, 705 (2017)
   PUBMED   28487679
  REMARK    DOI:10.3389/fmicb.2017.00705
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7533)
  AUTHORS   Mizukoshi,F., Matsushima,Y., Ishikawa,M. and Kimura,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2017) Contact:Mariko Ishikawa Kawasaki City
            Institute for Public Health, Division of Virology; Tonomachi
            3-25-13, Kawasaki-ku, Kawasaki, Kanagawa 210-0821, Japan
FEATURES             Location/Qualifiers
     source          1..7533
                     /organism="Norovirus
                     Hu/GII/JP/2010/GII.P16_GII.2/Ehime-44"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII/JP/2010/GII.P16_GII.2/Ehime-44"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:1934306"
                     /country="Japan: Ehime"
                     /collection_date="2010"
                     /note="genotype: GII.P16_GII.2"
     gene            5..5101
                     /gene="POL"
     CDS             5..5101
                     /gene="POL"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="BBB87058.1"
                     /translation="MKMASNDANVAVACNNNNDKEKSSGEGLFTNVSSTLKKALGARP
                     KQSVPRDNSQKPPRPPTPELVKRIPPPPPNGEEEEPVIRYEVKGGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLEDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDVE
                     KAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVITFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVIIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPPLDQNESEAKEEV
                     PKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEVKIRQRIFRPTRKQRKEERTTLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVNFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVSIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     gene            5082..6710
                     /gene="VP1"
     CDS             5082..6710
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="BBB87059.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDVPAPLGVPDFQGRVFG
                     IISQRDKHNGPGQNEPANRGHDAVVPTYTAQYTPKLGQVQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYVPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6710..7489
                     /gene="VP2"
     CDS             6710..7489
                     /gene="VP2"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="BBB87060.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLIAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSDSTRNTSLSQSTISRATSRTSEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESHA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctaa cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatgtg tcttccacct taaagaaagc
      121 cctcggggcc cggcccaaac agtctgtccc gagggacaac tcacaaaagc ccccaagacc
      181 accaactccc gagttggtta agaggatacc ccctccccca cctaatggtg aagaagaaga
      241 accagtcatt aggtatgagg ttaagggtgg gatctctggc ctgcccgagc tcacaacagt
      301 cccccaaccg gatgtggcca acacggcatt cagtgtccca ccgctgagct tgagagaaaa
      361 cagggaggcc aaggagccgc tgacaggggc aatattggag atgtgggatg gagagatata
      421 ccactatggc ctgtacgtgg agaaaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 tataagcatg gcaaaagtgg agctgacgcc gttgtcattg tactggcgtg tggtctacac
      541 cccccaatac ctcatctccc ctgaaactct caggaggctc aacggagagg cattccctta
      601 caccgccttt gacaacaact gctatgcctt ttgctgctgg gtgttagacc tcaatgactc
      661 atggcttaac aggaggatgg tgcaaagaac aacaggcttc ttcagacctt accaagagtg
      721 gaacagaaaa cccctgccta ctatggatga ctccaaaatc aagaaggtgg caaacatatt
      781 cctgtgttca ttgtccacgt tgttcaccag acctataaaa gacctcatag gaaaaattaa
      841 accattaaac atcttgaaca tcctggcaac gtgtgactgg acattcgccg gaatagtgga
      901 gtctctgata ttacttgctg agctctttgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cccttacttg aagactacga gttgcaaggg ccagaagacc tcgccgttga
     1021 gctcgtacct gtggtaatgg gagggattgg tttggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcatcaac gctcagggct tgtaaagatc ttggtgccta
     1141 tggcttagag atactcaaat tagtcatgaa gtggttcttc ccaaagaaag aagaggccaa
     1201 tgagctagcc atggtgagag ctatagagga tgctgtactg gatcttgagg caatagaaaa
     1261 taatcacatg acaactctgt tgaaagacaa agacagccta gcaacctaca tgaaaacact
     1321 agacatggaa gaggagaaag ccagaagatt gtccacaaaa tctgcatccc ctgacatagt
     1381 tgggacgatc aacgccctgc tggctcgaat agcagcggca aggtcactag tccacagggc
     1441 caaggaggag ttatctagca ggataagacc agtagttgtt atgatatctg gcaaaccagg
     1501 gataggaaaa actcatttgg ccagggaggt ggcaagaaag gtggcatcca ctctcacagg
     1561 ggatcaaaga gtcggactca taccgagaaa cggcgtggac cattgggatg catacaaagg
     1621 tgagagagtc gtgctgtggg acgactatgg catgagcaac cccattcatg atgctttgcg
     1681 catacaagaa ttggctgata cgtgtcccct caccttaaat tgcgacagaa ttgaaaataa
     1741 gggaaaagtt tttgacagtg aagtcataat aattacaaca aaccttgcca atccagctcc
     1801 acttgattat gtcaactttg aggcctgttc caggagaatt gatttcctgg tgtacgccga
     1861 ggcaccagac gtagaaaagg caaaacgaga ctttcctgga caaccagata tgtggaagga
     1921 cgcattcaag tcggactttt cacatatcaa gttgcaactt gcacctcagg gcggctttga
     1981 caagaatggc aacaccccac atgggaaagg agtgatgaag accctcacca ccggttccct
     2041 gattgcccgt gcatcaggct tactgcatga gaggatggat gaatttgaac tccaaggccc
     2101 cacagtcatc accttcaatt tcgaccggaa cagaatcacc gcattcagac aattggctgc
     2161 agaaaacaag tatgggttgg tggacaccat gagagttggc aatcaattaa aaggggtgaa
     2221 aaccatggaa gaactcaaac aagcaatcaa gaatgtgatc atcaagaggt gccggatcat
     2281 ctacggtggc tccacgtatg acctcgaatc tgatggcaag ggcaaagttt tggtggaaaa
     2341 ggtcaagaac acctctgtac agaccaacaa cgaattggcc ggagccctgc atcacctcaa
     2401 acatgcccga atcaggtact atgtcaaatg tgtgcaagaa gcagtttact ctatcataca
     2461 aattgccggc gctgcgtttg tcaccacacg cattgcacgc cgcatgaaca tacaagagct
     2521 ttggtcgaag ccaccattag accaaaatga atcagaggct aaggaagagg tccccaagtc
     2581 agaagatgac gagttcatca tatcttctaa ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca agaaacacac tgcattctct agcaagggct tgagcgatga
     2701 ggagtatgac gagtacaaga ggataagaga agagagaaat gggaagtact ctatagagga
     2761 gtatcttcaa gacagagaca ggtactatga ggaactcgcc atcgccaagg ccacggaaga
     2821 agacttctgt gaggaggagg aggtcaaaat ccgtcagagg atcttccgtc ccaccaggaa
     2881 acaaaggaag gaagagagga ccacactagg actagtaact ggttcagaaa tcagaaaaag
     2941 gaaccctgat gacttcaaac ctaaagggaa actgtgggcc gatgacaaca gaagtgttga
     3001 ctacaatgag aaactggact ttgaggcccc cccaagtata tggtctagga ttgtgaattt
     3061 tggttctggt tggggcttct gggtatcacc aagcctgttc ataacatcaa ctcatgtaat
     3121 ccctgcaggc ataacagagg catttggagt ctccatcaaa caaatccagg tccacaaatc
     3181 aggtgaattt tgccggttca gattcccaaa accaattaga ccagatgtga caggaatgat
     3241 cttggaagaa ggtgcgcctg agggcaccgt ggcaaccgtg ctcatcaaac gccctaccgg
     3301 agagctcatg ccccttgcag ccagaatggg gacacacgca accatgaaaa ttcaaggccg
     3361 catggttggc ggacagatgg gtatgttgct cactggttca aatgctaaag gaatggattt
     3421 gggaacaact cctggtgatt gtggctgtcc ctacatctac aaaaggggca atgactatat
     3481 agtcattggt gtgcacacag cagcagcccg tggtggaaac accgtcatct gtgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacat attgtggggc
     3601 acccattcta ggccccgggg gggcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacacg cctcttccac cagggacata tgagcctgcc tacctcggtg gccgcgaccc
     3721 gcgtgttaag ggtgggccct ccttgcagca ggtaatgaga gaccagttga aaccattcac
     3781 tgaacccagg ggtaaacctc caagaccaag tgtgttggaa gcagccaaac aaaccatcat
     3841 caatgtcctc gaacaaaccc tggaccctcc acaaaaatgg acgtacgcac aggcgtgtgc
     3901 ttcacttgac aaaaccacct ccagcgggca tccccaccac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gtaaattggc agaccaagca tcaaaagcaa acctgatgtt
     4021 tgaggaaggt aaacacatga caccagtgta tacagcagcc cttaaggacg agctggtcaa
     4081 gactgacaaa gtctatggaa agatcaagaa gagactgctc tggggctctg acttgtccac
     4141 catgatccgg tgcgccaggt cctttggtgg gctcatggat gagatgaagg cacactgcat
     4201 atcactccca gttcgagttg gcatgaacat gaatgaagat ggtccaataa tatttgagaa
     4261 gcactccaga tacaagtacc actatgatgc agactactcc cgctgggatt caacacaaca
     4321 gagggcagta ctagcagcag ccttggaaat catggtcagg ttctctgcag agccacaatt
     4381 ggcacagata gtcgctgagg atctgctggc ccccagtgtg gtagatgtag gagactttaa
     4441 aatttcaata aatgaagggc tcccctctgg tgtaccatgc acttctcaat ggaattccat
     4501 cgcacactgg ctgctaaccc tctgtgcctt gtctgaagtc accaaactgt cccctgacat
     4561 tgtacaggca aattccatgt tctcatttta cggtgatgac gagattgtca gcaccgatat
     4621 aaaattggac cctgaaaagt tgaccaccaa attgaaggag tacggcctga aaccaacccg
     4681 cccagacaaa actgaggggc ccctgatcat cagtgaagat ttgaacggac tcacttttct
     4741 ccggaggacg gtgactcgtg acccagctgg ctggtttgga aaattggacc aaagttcaat
     4801 attgaggcag atgtactgga ctagaggacc aaatcatgaa gaccccaatg agacaatgat
     4861 accccactct caaagaccca tacagctcat ggcactgctt ggtgaggctt cccttcacgg
     4921 accctctttc tacagcaaaa tcagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggacttttac gtgccaaggc aggaacccat gttcaggtgg atgaggtttt ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctactgat ggtgcagccg gcctcgtgcc agaaagtaac aatgaggtca
     5161 tggctcttga acccgtggct ggtgccgcct tggcagcccc ggtcaccggt caaacaaata
     5221 ttatagaccc ttggattaga gcaaattttg tccaggcccc caatggcgaa tttacagtct
     5281 ctccccgtaa tgcccctggt gaagtgctat taaatctaga gttgggtcca gaattaaatc
     5341 cttatctggc acatttagca agaatgtaca acgggtatgc cggtgggatg gaggtgcagg
     5401 tcatgttggc tgggaacgcg ttcacagccg gcaagttggt cttcgccgcc gtgccacctc
     5461 acttcccggt tgaaaacctt agcccacagc aaattaccat gttccctcat gtgattatag
     5521 atgtaaggac cttggaacct gttttattac cactccctga tgttaggaat aatttctttc
     5581 actataatca gaaagatgat cccaaaatga gaattgtggc tatgctttac acccccctta
     5641 ggtctaatgg ttcaggtgat gatgtgttca cagtttcctg cagggtgttg actagaccct
     5701 cccctgattt tgacttcaca tatctggtgc caccaacagt ggaatctaaa acaaaaccat
     5761 tcaccctccc aatcctcaca cttggggaac tttccaactc taggttccca gtgtccatag
     5821 accagatgta caccagccct aatgaagtta tatcagtgca gtgtcaaaat ggtaggtgca
     5881 cattggacgg ggagcttcaa gggacaacac aactccaagt cagtggcatt tgtgctttca
     5941 agggggaagt gaccgcccat ttgcacgaca atgatcacct atacaatgtc accatcacaa
     6001 acttgaatgg gtcccctttt gacccctccg aggacgttcc tgcccctctg ggcgtgcctg
     6061 atttccaggg aagggtcttt ggtatcatct cccaaagaga caaacacaat ggccctgggc
     6121 aaaatgaacc agcaaacagg ggacacgacg ctgtggtccc tacttacaca gcacagtaca
     6181 ctccaaaatt gggtcaggtt caaattggca catggcagac cgacgatctt acagtcaacc
     6241 aaccagtcaa attcacccca gttggactca atgacactga acattttaat caatgggtgg
     6301 tccccagata cgctggtgcc ctaaacctca acacaaacct tgccccttct gttgccccag
     6361 tatttccagg ggagcgccta cttttcttca gatcatacgt tcccctcaag ggtggttatg
     6421 gaaatccagc cattgattgc ctattaccac aagagtgggt gcaacacttc tatcaggagg
     6481 ctgccccatc aatgagtgag gtggcccttg tcagatacat taacccggat actggtcggg
     6541 cgctgtttga ggccaagctc cacagagctg gtttcatgac agtctcgagc aacaccagtg
     6601 ccccggtggt tgtgcctgcc aatgggtact tcagatttga ctcttgggtt aatcaattct
     6661 attctctcgc ccccatggga actggaaatg ggcgtagaag ggttcaataa tggctggagc
     6721 ttttgtagct ggtcttgcag gggacgtgct cagcaatggg ctcagttcat taattaatgc
     6781 aggtgctaat gcaataaatc agagggcaga atttgatttt aatcagaaat tacagcaaaa
     6841 ttctttcaat catgataagg agatgttgca ggcccagatc caggcaacta agcagctgca
     6901 ggcagacatg atggctataa aacagggggt cctgatcgct ggcggctttt cccctgctga
     6961 tgcagccaga ggtgctgtga atgcgcccat gacacaggcg ctggattgga acggcacaag
     7021 gtattgggca ccaggttcta tgaggaccac atcttattct ggaaaattta catcaaccgc
     7081 cccagtgaga caggccgact tccagcacac ccaaagccgg ccttcgagtg gttcttctgt
     7141 gtcctccttt gccactcagt cttcaaggcc aactctgacc acaaccactg ggtcctcaca
     7201 tggcacagcc tcatcagatt caactcgcaa cacaagcctc tcccaatcaa cgatctctag
     7261 agctacatct aggactagtg agtgggttag agaccaaaat agaaatttgg aaccctacat
     7321 gcatggtgcc ttacagacgg cctttgtcac cccaccttcc agcagggcgt ctgacgggac
     7381 agtctcaacc gtcccaaaag gtgttttgga ctcctggaca cctgcgttca acacccgcag
     7441 gcagccgctc ttcgcacacc tccgtaagag gggggagtca catgcctagt gaaaaggtga
     7501 aaatttgttt agaataaatt gattttacct ttc
//