Typing tool

Complete norovirus genomes

LC209467  GII.2
 GII.P16

Length: 7,523 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6710
ORF3: 6710..7489
LOCUS       LC209467                7523 bp    RNA     linear   VRL 14-DEC-2017
DEFINITION  Norovirus Hu/GII/JP/2011/GII.P16_GII.2/Hokkaido-17 RNA, complete
            genome.
ACCESSION   LC209467
VERSION     LC209467.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/JP/2011/GII.P16_GII.2/Hokkaido-17
  ORGANISM  Norovirus Hu/GII/JP/2011/GII.P16_GII.2/Hokkaido-17
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Mizukoshi,F., Nagasawa,K., Doan,Y.H., Haga,K., Yoshizumi,S.,
            Ueki,Y., Shinohara,M., Ishikawa,M., Sakon,N., Shigemoto,N.,
            Okamoto-Nakagawa,R., Ochi,A., Murakami,K., Ryo,A., Suzuki,Y.,
            Katayama,K. and Kimura,H.
  TITLE     Molecular Evolution of the RNA-Dependent RNA Polymerase and Capsid
            Genes of Human Norovirus Genotype GII.2 in Japan during 2004-2015
  JOURNAL   Front Microbiol 8, 705 (2017)
   PUBMED   28487679
  REMARK    DOI:10.3389/fmicb.2017.00705
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7523)
  AUTHORS   Mizukoshi,F., Matsushima,Y., Ishikawa,M. and Kimura,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2017) Contact:Mariko Ishikawa Kawasaki City
            Institute for Public Health, Division of Virology; Tonomachi
            3-25-13, Kawasaki-ku, Kawasaki, Kanagawa 210-0821, Japan
FEATURES             Location/Qualifiers
     source          1..7523
                     /organism="Norovirus
                     Hu/GII/JP/2011/GII.P16_GII.2/Hokkaido-17"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII/JP/2011/GII.P16_GII.2/Hokkaido-17"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:1934293"
                     /country="Japan: Hokkaido"
                     /collection_date="2011"
                     /note="genotype: GII.P16_GII.2"
     gene            5..5101
                     /gene="POL"
     CDS             5..5101
                     /gene="POL"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="BBB87019.1"
                     /translation="MKMASNDANVAVAYNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQSAPRDNSQKPPRPPTPELVKRIPPPPPNGEEEEPVIRYEVKSGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLEDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVE
                     KAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVIIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSIQTNNELAGALHHL
                     KHARIRYYVRCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPPLDQNESEAKEEA
                     PKSEDDEFIISSKDIKEEGKKGKNKTGRGRKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEVKIRQRIFRPTRKQRKEERATLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLRPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQALDPPQKWTYAQACASLDKTTSSGYPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     gene            5082..6710
                     /gene="VP1"
     CDS             5082..6710
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="BBB87020.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLSLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDVPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYVPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6710..7489
                     /gene="VP2"
     CDS             6710..7489
                     /gene="VP2"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="BBB87021.1"
                     /translation="MAGAFMAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGKFTSIAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTGLSQSTVSRATSRTSEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESHA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctaa cgttgccgtt gcttacaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggcc cggcccaaac agtccgcccc gagggacaac tcacaaaaac ccccaagacc
      181 accaactccc gagttggtta agaggatacc ccctccccca cctaatggtg aagaagaaga
      241 gccagtcatt aggtatgagg ttaagagtgg gatctctggc ctgcccgagc tcacaacagt
      301 cccccaaccg gatgtggcca acacggcatt cagtgtccca ccgctgagct tgagagaaaa
      361 cagggaggcc aaggaaccgc tgacaggggc aatattagag atgtgggatg gagagatata
      421 ccactatggc ctgtacgtgg agaaaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 tataagcatg gcaaaagtgg agctgacgcc gttgtcattg tactggcgtg tggtctacac
      541 cccccaatac ctcatctccc ctgaaactct caggaggctc aacggagagg cattccctta
      601 caccgccttt gacaacaatt gctatgcctt ttgctgctgg gtattagacc tcaatgactc
      661 atggcttaat aggaggatgg tacaaaggac aacaggcttc ttcagacctt accaagagtg
      721 gaacagaaaa cccctgccta ctatggatga ctccaaaatc aagaaggtgg caaacatatt
      781 cctgtgttca ttgtccacgt tgttcaccag acctataaaa gacctcatag gaaaaattaa
      841 accattaaac atcttgaaca tcctggcaac gtgtgactgg acattcgccg gaatagtgga
      901 gtctctgata ttacttgctg aactctttgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cccttacttg aagactacga gttgcaaggg ccagaagacc tcgccgttga
     1021 gctcgtacct gtggtaatgg gagggattgg tttggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcatcaac gctcagggct tgtaaggatc ttggtgccta
     1141 tggcttagag atactcaaat tggtcatgaa gtggttcttc ccaaagaaag aagaggccaa
     1201 tgagctagcc atggtgagag ctatagagga tgctgtgttg gatcttgagg caatagaaaa
     1261 taatcacatg acaactctgt tgaaagacaa agacagccta gcaacctaca tgaaaacact
     1321 agacatggaa gaggagaaag ccagaagatt gtccacaaaa tctgcatccc ctgacatagt
     1381 tgggacgatc aacgccctgc tggctcgaat agcagcggct aggtcattag tccacagggc
     1441 caaggaggag ttatctagca ggataagacc agtagttgtt atgatatctg gcaaaccagg
     1501 gataggtaaa actcatttgg ccagggaggt ggcaagaaag gtggcatcca ctctcacagg
     1561 ggatcaaaga gtcgggctca taccgagaaa cggtgtggac cactgggatg catacaaagg
     1621 tgagagagtc gtgctgtggg acgactatgg catgagcaac cccattcatg atgctttgcg
     1681 catacaagaa ttggctgata cgtgtcccct taccttaaat tgcgacagaa ttgaaaataa
     1741 gggaaaagtt tttgacagtg aagtcataat aattacaaca aaccttgcca atccagctcc
     1801 acttgattat gtcaactttg aggcctgttc caggagaatt gacttcctgg tgtacgccga
     1861 ggcaccagaa gtagaaaagg caaaacgaga ctttcctggt caaccagata tgtggaagga
     1921 cgccttcaag tcggactttt cacatatcaa gttgcaactt gcacctcagg gcggctttga
     1981 caagaatggt aacaccccac atgggaaagg agtgatgaag accctcacca ccggttccct
     2041 gattgcccgt gcatcaggct tactgcatga gaggatggat gaatttgaac tccaaggccc
     2101 cacagttacc accttcaatt tcgaccggaa cagaatcacc gcattcagac aattggccgc
     2161 agaaaacaag tatgggttgg tggacaccat gagagttggc aatcaattaa aaggggtgaa
     2221 aaccatggaa gaactcaaac aagcaatcaa gaatgtgatc atcaagaggt gccggatcat
     2281 ctacggtggc tccacgtatg accttgaatc tgatggcaag ggcaaagttt tggtggaaaa
     2341 ggtcaagaac acctctatac agaccaacaa cgagttggct ggagccctgc atcacctcaa
     2401 acatgcccga atcaggtatt atgtcagatg tgtgcaagaa gcagtttact ctatcataca
     2461 gattgccggc gctgcgtttg tcaccacacg cattgcacgc cgcatgaaca tacaagagct
     2521 ttggtcgaag ccaccattag accaaaatga atcagaggct aaggaagagg cccccaagtc
     2581 agaagatgac gagttcatca tatcttctaa ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca ggaaacacac tgcattctct agcaagggct tgagcgatga
     2701 ggagtatgac gagtacaaga ggataagaga agagagaaat gggaagtact ctatagagga
     2761 gtatcttcaa gacagagaca ggtactatga ggaactcgcc atcgccaagg ccacggaaga
     2821 agacttctgt gaggaggagg aggtcaaaat ccgtcagagg atcttccgtc ccaccaggaa
     2881 acaaaggaag gaagagaggg ctacactagg actagtaact ggttcagaaa tcagaaaaag
     2941 aaaccctgat gacttcaaac ctaaagggaa actgtgggcc gatgacaaca gaagtgttga
     3001 ctacaatgag aaactggact ttgaggcccc cccaagcata tggtctagga ttgtgagttt
     3061 tggttctggt tggggcttct gggtatcacc aagcctgttc ataacatcaa ctcatgtaat
     3121 ccctgcaggc ataacagagg catttggagt ccccatcaaa caaatccagg tccacaaatc
     3181 aggtgaattt tgccggttca gattcccaaa accaattaga ccagatgtga caggaatgat
     3241 attggaagaa ggtgcgcctg agggcaccgt ggcaaccgta ctcatcaaac gccctaccgg
     3301 agagctcatg ccccttgcag ccagaatggg gacacacgca accatgaaga ttcaaggccg
     3361 catggttggc ggacagatgg gtatgttgct cactggttca aatgctaaag gaatggattt
     3421 gggaacaact cctggtgatt gtggctgtcc ctacatctac aaaaggggca atgactatat
     3481 agtcattggg gtgcacacag cagcagcccg tggtggaaac accgtcatct gtgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacat actgtggagc
     3601 acccattcta ggccccgggg gggcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacacg cctcttccac cagggacata tgagcctgcc tacctcggtg gccgtgaccc
     3721 gcgtgttaag ggtgggccct ccttgcagca ggtaatgaga gaccagttga gaccattcac
     3781 tgaacccagg ggtaaacctc caagaccaag tgtgttggag gcagccaaac aaaccatcat
     3841 caatgtcctc gaacaagccc tggaccctcc acaaaaatgg acatacgcac aggcgtgtgc
     3901 ttcacttgac aaaaccacct ccagcgggta tccccaccac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gtaaattggc agaccaagca tcaaaagcaa atctgatgtt
     4021 tgaggaaggg aaacacatga caccagtgta tacagcagcc ctcaaggacg agctggtcaa
     4081 gactgacaaa gtctatggaa agatcaagaa gagactgctc tggggctctg acttgtccac
     4141 catgatccgg tgcgccaggt cctttggtgg gcttatggat gagatgaagg cacactgcat
     4201 atcgctccca gtccgagttg gcatgaacat gaatgaagat ggtccaataa tatttgagaa
     4261 gcactccaga tacaagtacc actatgatgc agactactcc cgctgggatt caacacaaca
     4321 gagggcagta ctagcagcag ccttggaaat catggtcagg ttctctgcag agccacaatt
     4381 ggcacagata gtcgctgagg atctgctggc ccccagtgtg gtagatgtag gagactttaa
     4441 aatttcaata aatgaggggc tcccctctgg tgtaccatgc acttctcaat ggaattccat
     4501 cgcacactgg ctgctaaccc tctgtgcctt gtctgaagtc accaaactgt cccctgacat
     4561 tgtacaggca aattccatgt tctcatttta cggtgatgac gagattgtca gcaccgatat
     4621 aaaattggat cctgaaaagt taaccaccaa attgaaggag tatggcctga aaccaactcg
     4681 cccagacaaa accgagggac ccctgatcat cagtgaggat ttgaatggac tcactttcct
     4741 ccggaggacg gtgactcgtg acccagctgg ctggtttgga aaattggacc aaagctcaat
     4801 attgaggcag atgtactgga ctagaggacc aaatcatgaa gaccccaatg agacaatgat
     4861 accccactct caaagaccca tacagctcat ggcactgctt ggtgaggcct cccttcacgg
     4921 accctctttc tatagcaaaa tcagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggacttttac gtgccaagac aggaacccat gttcaggtgg atgaggtttt ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctactgat ggtgcagccg gcctcgtgcc agaaagtaac aatgaggtca
     5161 tggctcttga acccgtggct ggtgccgcct tggcagcacc ggtcaccggt caaacaaata
     5221 ttatagaccc ttggattaga gcaaattttg tccaggcccc caatggcgaa tttacagtct
     5281 ctccccgtaa tgcccctggt gaagtgctat tgagtctaga attgggtcca gaattaaatc
     5341 cttatctggc acatttagca agaatgtaca acgggtatgc cggtgggatg gaggtgcagg
     5401 tcatgttggc tgggaatgcg ttcacagccg gcaagttggt cttcgccgct gtgccacctc
     5461 acttcccggt tgaaaacctt agcccacagc aaattaccat gttccctcat gtgattatag
     5521 atgtaaggac cttggaacct gttttattac cactccctga tgttaggaat aatttcttcc
     5581 attataatca gaaagatgat cccaaaatga gaattgtggc tatgctttat acccccctta
     5641 gatctaatgg ttcaggtgat gatgtgttta cagtttcctg cagggtgttg accagaccct
     5701 cccctgattt cgatttcaca tatctggtgc caccaacagt ggaatctaaa acaaaaccat
     5761 tcaccctccc aatcctcaca cttggggaac tttccaattc taggttccca gtgtccatag
     5821 accagatgta caccagccct aatgaagtta tatcagtgca gtgtcaaaat ggtaggtgca
     5881 cattggacgg ggaacttcaa gggacaacac aactccaagt cagtggcatt tgtgctttca
     5941 agggggaagt gaccgcccat ttgcatgaca atgatcacct atacaatgtc accatcacaa
     6001 acttaaatgg gtcccctttt gacccctccg aggacgttcc tgcccctctg ggcgtgcctg
     6061 atttccaggg aagggtcttt ggtattatct cccaaagaga taaacataat agccctgggc
     6121 ataatgaacc agcaaacagg ggacacgacg ctgtggtccc tacttacaca gcacagtaca
     6181 ctccaaaatt gggtcagatt caaattggca catggcagac cgatgatctt acagtcaacc
     6241 aaccagtcaa attcacccca gttggactca atgacactga acattttaat caatgggtgg
     6301 tccccagata cgctggtgcc ctaaacctca acacaaacct tgccccttct gttgctccgg
     6361 tatttccagg ggagcgcctg cttttcttca gatcatacgt tcccctcaag ggtggttatg
     6421 gaaatccagc cattgattgc ctattaccac aagagtgggt gcaacacttc tatcaggaag
     6481 ctgccccatc aatgagtgag gtggcccttg tcagatacat caacccggat actggtcggg
     6541 cactgtttga ggccaagctc cacagagctg gtttcatgac agtctcgagc aacaccagtg
     6601 ccccggtggt tgtgcctgcc aatgggtact tcagatttga ctcttgggtt aatcaattct
     6661 attctctcgc ccccatggga actggaaatg ggcgtagaag ggttcaataa tggctggagc
     6721 ttttatggct ggtcttgcag gggacgtgct cagcaatggg ctcagttcat taattaatgc
     6781 aggtgctaat gcaataaatc agagggcaga atttgatttt aatcagaaat tacagcaaaa
     6841 ttctttcaat catgataagg agatgttgca ggcccagatt caggcaacta agcagctgca
     6901 ggcagacatg atggctataa aacagggggt cctgaccgct ggcggctttt cccctgctga
     6961 tgcagccaga ggtgctgtga atgcgcccat gacacaggcg ctggattgga acggcacaag
     7021 gtattgggca ccaggctcta tgaggaccac atcttattct ggaaaattca catcaatcgc
     7081 cccagtgagg caggccgact tccagcacac ccaaagtcgg ccttcgagtg gctcttctgt
     7141 gtcctccttt gccactcagt cttcaaggcc aactctgacc acaaccactg ggtcctcaca
     7201 tggcacagcc tcatcaaatt caactcgcag cacaggcctc tcccaatcaa cggtctctag
     7261 agctacatct aggactagtg agtgggttag agatcaaaat agaaatctgg aaccctacat
     7321 gcatggtgcc ttacagacgg cctttgtcac cccaccttcc agcagggcgt ctgacgggac
     7381 agtctcaacc gtcccaaaag gtgttttgga ctcctggaca cctgcgttca acacccgcag
     7441 gcagccgctc tttgcacacc tccgtaagag gggggagtca catgcctagt gaaaaggtga
     7501 aaatttgttt gattctacct ttt
//