Typing tool

Complete norovirus genomes

LC209463  GII.2
 GII.P2

Length: 7,536 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       LC209463                7536 bp    RNA     linear   VRL 14-DEC-2017
DEFINITION  Norovirus Hu/GII/JP/2008/GII.P2_GII.2/Hokkaido-15 RNA, complete
            genome.
ACCESSION   LC209463
VERSION     LC209463.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/JP/2008/GII.P2_GII.2/Hokkaido-15
  ORGANISM  Norovirus Hu/GII/JP/2008/GII.P2_GII.2/Hokkaido-15
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Mizukoshi,F., Nagasawa,K., Doan,Y.H., Haga,K., Yoshizumi,S.,
            Ueki,Y., Shinohara,M., Ishikawa,M., Sakon,N., Shigemoto,N.,
            Okamoto-Nakagawa,R., Ochi,A., Murakami,K., Ryo,A., Suzuki,Y.,
            Katayama,K. and Kimura,H.
  TITLE     Molecular Evolution of the RNA-Dependent RNA Polymerase and Capsid
            Genes of Human Norovirus Genotype GII.2 in Japan during 2004-2015
  JOURNAL   Front Microbiol 8, 705 (2017)
   PUBMED   28487679
  REMARK    DOI:10.3389/fmicb.2017.00705
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Mizukoshi,F., Matsushima,Y., Ishikawa,M. and Kimura,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2017) Contact:Mariko Ishikawa Kawasaki City
            Institute for Public Health, Division of Virology; Tonomachi
            3-25-13, Kawasaki-ku, Kawasaki, Kanagawa 210-0821, Japan
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus
                     Hu/GII/JP/2008/GII.P2_GII.2/Hokkaido-15"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII/JP/2008/GII.P2_GII.2/Hokkaido-15"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:1934289"
                     /country="Japan: Hokkaido"
                     /collection_date="2008"
                     /note="genotype: GII.P2_GII.2"
     gene            5..5104
                     /gene="POL"
     CDS             5..5104
                     /gene="POL"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="BBB87007.1"
                     /translation="MKMASNDASAAAAVNSNNDNTKSSSDGMLNNMAVTLKRALGARP
                     KQPAPGEKPPRPPRPPTPELVKRIPPPPPNDGDEPTVMFSTVGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLIPPDTLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILMAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPPLSTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIKNIIIRKCQIVYSGNTYTLESDGKGKVVVERVQSTSVQINNEIAGAVHHLR
                     CARVRYYVKCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNLWSRPLAEDADEATMKEGC
                     PKPREEEEFVVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRVVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKTFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGYPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGNIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     gene            5085..6713
                     /gene="VP1"
     CDS             5085..6713
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="BBB87008.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEIVSVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7492
                     /gene="VP2"
     CDS             6713..7492
                     /gene="VP2"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="BBB87009.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQRLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMKTTSYSGRFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGIASSNSTRSTNLSQSTVSRATSRTGEWVRDQNRNLGPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc tgctgccgct gctgttaaca gcaacaacga
       61 caacacaaaa tcttcaagtg acggaatgct taacaacatg gccgtcaccc tcaaacgagc
      121 ccttggggcc cggcccaaac agccggcccc gggggaaaaa cccccaagac cccctagacc
      181 accaacgcca gaattagtca aaagaatccc ccccccacca cccaatgatg gggacgaacc
      241 aaccgtgatg tttagcactg taggtggtgt gtctggccta cctgagctca caacagtcgg
      301 tcaaccgcct gaagctaaca cggcctttag tgtgcctccc ctcagccaaa gggaaaacag
      361 ggacgctaag gaaccgctaa ctgggactat tctggaaatg tgggatgggg agatctatca
      421 ttatggactg tatgtggaaa gagggcttgt attaggcgtg cacaagccac cagctgccat
      481 tagcatagcc aaagtggaat taacgcccct ttcactgtat tggagacctg tgtacacgcc
      541 tcaatacctt atacctcctg acaccttgag gaaactccat ggtgaattgt ttccctatac
      601 agcctttgaa aacaactgtt atgccttctg ctgttgggtt ttggatctta acgattcatg
      661 gctaagcagg aggatgatta gtaggaccac tggcttcttc aggccctacc aagagtggaa
      721 caggaagccc cttccaacta tggatgactc aaaattgaag aaggtcgcaa acatcgttct
      781 gtgtgcattg tcatcattgt ttactagacc catcaaggat ataattggca aacttaaacc
      841 cctcaacatc ctaaacattt tggcctcatg cgattggacc ttcgctggca tagtggagtc
      901 actaatcctc atggctgaac tctttgatgt gttctggaca cccccagatg tgtctgcaat
      961 gatcgcaccc ctcctcggtg actacgagct acaaggcccc gaagacatcg ctgtggagct
     1021 cgtgcccgtt gtgatgggtg ggataggtct ggtgttggga ttcaccaaag agaaaatagg
     1081 caagatgctc tcctctgcag catcaactct gagggcatgc aaagatctcg gagcctacgg
     1141 attagagatc ttgaaactag tcatgaaatg gtttttccca aagaaggatg aggccaacga
     1201 actggctatg gtcagagcca ttgaagacgc tgtattagac ctggaggcca ttgagaacaa
     1261 ccatatgacc actctattga aagataagaa cagccttgca gcctacatga agaccttgga
     1321 catggaagaa gagaaagcta ggaagttatc caccaaatca gcctcccctg atattgtggg
     1381 cacaataaat gccctgctgg ccaggatcgc cgccgcgcgc tccttggtcc atagggccaa
     1441 ggaggagctc tccagcagac caagaccggt cgttctaatg atctctggta aaccagggat
     1501 aggaaagacc cacctggcca gagaactggc aaagaaaatt gcctcgacac tcacagggga
     1561 ccagagggtg ggcctcatcc cacggaacgg agtcgaccac tgggacgcct acaaaggcga
     1621 gagagtggtg ctctgggatg attacgggat gagcaacccc atccacgatg cactgaggtt
     1681 gcaggaactg gcagacacat gtccattaac tctgaattgt gacaggattg aaaacaaggg
     1741 gaaagtcttc gatagtgacg cgatcataat cactaccaac ttggtcaatc ccgcgccgct
     1801 ggattacgtc aactttgagg cctgctccag acgtatagac ttccttgtgt atgctgatgc
     1861 cccagaagtc gagaaggcaa agcgggactt ccctggtcaa ccggacatgt ggaaggacgc
     1921 ctatcgctct gacttctcac acattaaact acaacttgca ccacaaggtg ggtttgacaa
     1981 aaatggtaac accccacatg gtaaaggagt gatgaagact ctcactgcca gttcactagt
     2041 tgcgcgtgcc tctggtctcc tgcatgagag attagatgag tacgagctac agggtccgcc
     2101 cctctcaacc ttcaactttg accgcaacaa aattgcagcg ttcaggcaac tcgccgctga
     2161 aaataagtat ggtctggtgg acactatgag ggtgggcaac cagctcagaa atgttacgac
     2221 catggatgaa ctcaagaagg ctatcaagaa cattataatc agaaagtgcc agatagtcta
     2281 tagtggtaac acctacacgc ttgagtccga cggcaagggt aaggttgtgg ttgagagggt
     2341 gcagagcaca agcgtgcaaa ttaacaatga gatcgctggt gcagtacacc accttagatg
     2401 tgccagggta aggtattatg tcaagtgtgt ccaagaggcc atttactcac tcctccaaat
     2461 cgccggcacg gtgtttgtca cttcacgcat cgtaagccgc atgaacatcc aaaatttatg
     2521 gtccaggcca ttagccgaag atgcagatga ggccaccatg aaagaggggt gccccaaacc
     2581 tagggaagag gaggagtttg tcgtctcctc agatgacatc aagccagagg gcaagaaagg
     2641 taaaaacaag agtggccggg gcaagaaaca cacggcattc tcaagtaaag gtctcagtga
     2701 tgaggagtac gaagagtaca aaagaatcag agaggagaga aacggcaagt actccataga
     2761 ggaataccta caagacagag acaaatatta tgaagaggtg gccattgcta gggcaactga
     2821 agaagacttc tgcgaagagg aagaggttaa gattcgtcag aggatcttca gaccaacaag
     2881 aaaacaacgc aaggaagaaa gagccaacct tggcctcgtc actgggtctg agatcaggaa
     2941 gaggaaccca gatgacttca aaccaaaagg aaagctgtgg gccgacgatg ataggagcgt
     3001 cgactacaat gaaagaatca gctttgaagc cccaccaagt atttggtcta gaattgtcaa
     3061 ctttggttct ggatggggat tttgggtttc acctagcctc ttcataacat caacacatgt
     3121 tatacctcaa ggcataactg aggcctttgg tgtacctata aggcaggtgc aaatacacaa
     3181 gtcaggcgag ttttgtcgcc tgagattccc aaaacccatc aggacagatg tgtcaggcat
     3241 gatactggag gagggagcgc ctgaaggcac tgttgccacc atactcatca aaagaaccac
     3301 tggagagctg atgcctctcg cagcaagaat gggcacccat gcgaccatga gaatacaagg
     3361 acgcgtggta ggcggccaga tgggaatgtt gctcactgga tctaatgcaa agagcatgga
     3421 tcttggcacc acgcccggtg actgtgggtg cccctacatt tacaaaaggg gcaacgatta
     3481 catagtcatt ggagttcaca cggctgccgc tcgtggcgga aacactgtca tctgcgccac
     3541 acagggtagt gagggtgagg ccacgctcga gggtggtgac aacaaaggaa catactgtgg
     3601 ggcgccaata ctaggccccg gaaatgcccc aaaactgagc actaaaacca aattctggag
     3661 gtcctccaca acaccacttc cacccggcac atacgagccg gcgtatctgg gaggaaaaga
     3721 cccccgagtc aagggtggac catctctgca acaagttatg cgagaccaac tgaaaacatt
     3781 caccgaaccc cgtggtaagc caccaaaacc aagtgtcctc gaagctgcca aaaagacaat
     3841 tatcaatgtg ctagagcaaa caatagaccc cccacaaaag tggacgtacg cacaagcgtg
     3901 cgcgtctctc gacaaaacca catctagtgg atacccccat cacgtgcgca aaaacgaaca
     3961 ctggaacggg gagtctttca caggaaaatt ggctgaccag gcatcaaaag caaatctaat
     4021 gtttgaagag gggaaacaca tgaccccagt ttacacagct gcccttaagg atgagttggt
     4081 caaaactgag aaagtgtatg ggaatataaa gaaaagactg ctttggggct ccgatctggc
     4141 caccatggtg cggtgtgcgc gctcctttgg cggtttgatg gacgaactca aggcccactg
     4201 tgtgacactt ccgataaggg ttggcatgaa tatgaatgaa gatggaccaa tagtctttga
     4261 gaaacattcc agatacaggt atcactatga tgcagattat tccaggtggg attcaacaca
     4321 gcagagagcc gttctggccg cggccatgga gattatggtt aaattttcag cagaaccaca
     4381 gctagcccaa atagttgcag aggacctatt gtcgcctagc gtggttgacg tgggcgactt
     4441 taagatttca atcaatgaag ggttaccgtc gggtgtccct tgcacctctc aatggaattc
     4501 catcgcacac tggctcctca ccttatgtgc cctttctgaa gttacagacc tctctcctga
     4561 tattgtgcaa gccaactccc tcttctcctt ttatggtgat gatgaaattg tgagcacaga
     4621 tattaaatta gacccagaaa aactgacggg gaaattgaga gaatatggcc tcaaacccac
     4681 tcgtccagac aagactgagg gacccctgat cattagtgag gatctgaatg gtctgacttt
     4741 cctgaggagg accgtcactc gcgatcctgc aggatggttt ggtaagctgg accaaagctc
     4801 catacttagg caattgtact ggaccaaagg ccccaatcat gaagaccctt ttgagtcaat
     4861 gattccacac tcccagagac ccatacaact catgtcactc ttgggcgagg cagcactgca
     4921 tgaaccatca ttctacagca agatcagcaa gcttgtgata tctgagttga aagaaggtgg
     4981 aatggatttt tacgtgccca ggcaagaacc tatgtttaga tggatgagat tctcagattt
     5041 gagcacgtgg gagggcgatc gcaatcttgc tcccagtctt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aataatgagg
     5161 tcatggctct tgaacccgtg gctggtgccg ccttggcagc cccggtcacc ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccccaatggt gaatttacag
     5281 tctctccccg taatgcccct ggtgaagtgc tactaaatct agagttgggt ccagaattaa
     5341 acccttatct ggcacattta gcaagaatgt acaacgggta tgccggtggg atggaggtgc
     5401 aggtcatgtt ggctgggaac gcgttcacag ccggcaagtt ggtcttcgcc gctgtgccac
     5461 ctcacttccc ggttgaaaac cttagcccac agcaaattac catgttcccc catgtgatta
     5521 tagatgtaag gactttggaa cctgttttat taccactccc tgatgttaga aacaatttct
     5581 tccattataa tcagaaagat gatcccaaga tgagaattgt ggctatgctt tatacccccc
     5641 ttaggtctaa tggctcaggt gatgatgtgt ttacagtctc ctgcagggtt ttgactagac
     5701 cctcccctga ttttgatttc acatatctgg tgccaccaac agtggaatct aaaacaaaac
     5761 cattcaccct cccaatcctc acacttgggg aactttccaa ttctagattc ccagtgtcca
     5821 tagaccagat gtacaccagc cctaatgaaa tcgtatcagt gcagtgtcaa aatggtaggt
     5881 gcacattgga cggtgagctc caagggacaa ctcaactcca agtcagtggc atttgtgctt
     5941 tcaagggaga agtgaccgcc cacttgcatg acaatgatca cctgtataat gtcactatca
     6001 caaatttgaa tgggtcccct tttgacccct ccgaggacat ccctgcccct ctgggcgtac
     6061 ctgactttca gggaagggtc tttggtatca tctcccaaag ggacaaacac aatagtcctg
     6121 gacacaatga accagcaaac aggggacacg atgctgtggt tcctacttac acagcacagt
     6181 acactccaaa attgggtcag atccaaattg gcacatggca gaccgacgat cttacagtca
     6241 accaaccagt caaattcacc ccagttggac tcaatgacac tgaacatttt aaccaatggg
     6301 tggtccccag atatgctggt gccctaaacc tcaacacaaa ccttgcccct tctgttgctc
     6361 cagtatttcc aggggagcgc ctgctctttt tcagatcata cattcccctc aagggtggtt
     6421 atggaaatcc agccattgat tgcctactac cacaagagtg ggtgcaacat ttctatcagg
     6481 aagcagcccc ttcaatgagt gaggtggccc ttgtcagata catcaacccg gatactggtc
     6541 gggcactgtt tgaggccaag ctccatagag ctggtttcat gacagtctca agcaacacca
     6601 gtgccccggt ggttgtgcct gccaatggat acttcagatt tgactcttgg gtgaaccaat
     6661 tctattctct cgcccccatg ggaactggaa atgggcgtag aagggttcaa taatggctgg
     6721 agcttttgta gctggtcttg caggggacgt gctcagcaat gggcttagtt cattaattaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaatcaga gattacagca
     6841 aaattctttc aatcatgata aggagatgtt gcaggctcaa attcaggcaa ctaagcagct
     6901 gcaggcagac atgatggcta taaagcaggg ggttctgacc gctggcggct tctcccctgc
     6961 tgatgcagcc agaggtgctg tgaatgcgcc catgacacag gcgctggatt ggaacggcac
     7021 aaggtattgg gcaccaggct ccatgaagac cacatcttac tctggaagat tcacatcaac
     7081 cgccccagtg aggcaggccg acttccagca cacccaaagc cggccttcga gtggctcttc
     7141 tgtgtcctcc tttgccactc agtcttcaag gccaactctg accacaacca ctgggtcctc
     7201 acatggcata gcctcatcaa attcgactcg cagcacaaac ctctctcaat caacggtctc
     7261 tagggccaca tctaggactg gtgagtgggt tagagaccaa aatagaaatt tgggacccta
     7321 tatgcatggt gccttacaga cagcctttgt caccccacca tctagcaggg cgtctgacgg
     7381 gacagtctca accgtcccaa aaggtgtttt ggactcctgg acacctgcgt tcaacacccg
     7441 caggcagccg ctctttgcac acctccgtaa gaggggggag tcacaagctt agtgaaaagg
     7501 tgaaaattca tttaggatga actgatctta cctttt
//