Typing tool

Complete norovirus genomes

LC209445  GII.2
 GII.P16

Length: 7,531 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6707
ORF3: 6707..7486
LOCUS       LC209445                7531 bp    RNA     linear   VRL 14-DEC-2017
DEFINITION  Norovirus Hu/GII/JP/2012/GII.P16_GII.2/Saitama-122 RNA, complete
            genome.
ACCESSION   LC209445
VERSION     LC209445.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/JP/2012/GII.P16_GII.2/Saitama-122
  ORGANISM  Norovirus Hu/GII/JP/2012/GII.P16_GII.2/Saitama-122
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Mizukoshi,F., Nagasawa,K., Doan,Y.H., Haga,K., Yoshizumi,S.,
            Ueki,Y., Shinohara,M., Ishikawa,M., Sakon,N., Shigemoto,N.,
            Okamoto-Nakagawa,R., Ochi,A., Murakami,K., Ryo,A., Suzuki,Y.,
            Katayama,K. and Kimura,H.
  TITLE     Molecular Evolution of the RNA-Dependent RNA Polymerase and Capsid
            Genes of Human Norovirus Genotype GII.2 in Japan during 2004-2015
  JOURNAL   Front Microbiol 8, 705 (2017)
   PUBMED   28487679
  REMARK    DOI:10.3389/fmicb.2017.00705
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7531)
  AUTHORS   Mizukoshi,F., Matsushima,Y., Ishikawa,M. and Kimura,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2017) Contact:Mariko Ishikawa Kawasaki City
            Institute for Public Health, Division of Virology; Tonomachi
            3-25-13, Kawasaki-ku, Kawasaki, Kanagawa 210-0821, Japan
FEATURES             Location/Qualifiers
     source          1..7531
                     /organism="Norovirus
                     Hu/GII/JP/2012/GII.P16_GII.2/Saitama-122"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII/JP/2012/GII.P16_GII.2/Saitama-122"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:1934271"
                     /country="Japan: Saitama"
                     /collection_date="2012"
                     /note="genotype: GII.P16_GII.2"
     gene            5..5098
                     /gene="POL"
     CDS             5..5098
                     /gene="POL"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="BBB86953.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNPQKPPRPPTPELVKRIPPPPPNGEEEPVIRFEVKSGISGLPDLTTVPQPD
                     AINTAFSVPPLSLRENREAKEPLTGAIIEMWDGEIYHYGLYVEKGLVLGVHKPPAAIS
                     MAKVELAPLSLYWRVVYTPQYLISPDTLKRLNGEAFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDIIGK
                     IKPLNILNILATCDWTFAGIVESLILFAELFGVYWTPPDVSAMIAPLLGEYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRAIEDAVLDLEAIENNHMTALLKDKDSLATYMKTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAREV
                     AKKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKDAFKADFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERMDEFELQGPAITTFNFDRNRVTAFRQLAAENKYGLVDTMRIGNQLKGVKTM
                     EELKQAIKNVSIKRCQIIYHGSTFDLESDGKGKVTVEKVKNTTVQTNNELAGALHHLR
                     SARIRYYVKCVQEAIYSILQIAGAAFVTTRIARRMNIQELWSKPPLDQSEPEVKEETP
                     KLEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKY
                     SIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLVTG
                     SEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPSL
                     FITSTHVIPSGITEAFGVPIKQIQVHKSGEFCRLRFPKPIRPDVTGMILEEGAPEGTV
                     ATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDCG
                     CPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGPG
                     GAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPRG
                     KPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHARKNEFWNG
                     ETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDLST
                     MVRCARAFGGLMDEMKAHCISLPIRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDST
                     QQRAVLAAALEIMVRFSAEPQLAQTVAEDLLAPSVVDVGDFKISINEGLPSGVPCTSQ
                     WNSISHWLLTLCALSEVTNLSPDIVQVNSMFSFYGDDEIVSTDIKLDPEKLTTKLREY
                     GLKPTRPDKTEGPLIISEDLDGLTFLRRTVSRDPAGWFGKLDQSSILRQMYWTRGPNH
                     EDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEPM
                     FRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5079..6707
                     /gene="VP1"
     CDS             5079..6707
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="BBB86954.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     VISQRDKHNTPGHNEPANRAHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTDHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGTPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6707..7486
                     /gene="VP2"
     CDS             6707..7486
                     /gene="VP2"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="BBB86955.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQRLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLAAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTAYSGRFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSYGTTSSNSTRSTNLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcgggtg aaggcttatt tacaaatatg tcttccaccc taaagaaagc
      121 cctcggggct cggcctaaac agcctgcccc gagggacaac ccgcaaaaac ccccaagacc
      181 accaacgccc gagttggtta aaaggatacc ccctccccca cctaatggcg aagaagagcc
      241 agtcattagg tttgaggtca agagtggaat ttctggcctg cccgatctca cgacagtccc
      301 tcaaccagat gcgatcaata cggcattcag tgttccaccg ttgagcctaa gagaaaacag
      361 ggaggccaag gaaccgctaa ctggggcaat aatagagatg tgggatggag agatatacca
      421 ctatggtttg tatgtggaga aaggtctagt cttgggtgta cacaaaccac ccgcagctat
      481 aagcatggca aaagtggagt tagcaccgct gtcgttatac tggcgtgtgg tgtacactcc
      541 ccaatacctc atctcccctg acactctcaa gaggctcaac ggagaggcat tcccctacac
      601 cgcctttgat aataactgtt atgccttttg ctgctgggtg ttagacctta atgactcatg
      661 gctcagcaga agaatggtgc agagaacgac aggcttcttc agaccctacc aagagtggaa
      721 cagaaagccc ctacccacca tggatgattc caaaattaag aaggtggcaa acatattcct
      781 atgttcattg tctacactgt tcaccaggcc tataaaagac atcataggga aaatcaaacc
      841 actgaatatc ttaaacattc tggcaacgtg tgattggacg ttcgccggaa tcgtagagtc
      901 tctaatatta tttgctgaac tctttggagt ttactggaca cccccagatg tgtctgctat
      961 gatcgctccc ttacttggcg aatacgagtt gcagggacca gaagacatcg ccgttgagct
     1021 cgtgcctgta gtgatggggg ggattggttt ggtgctagga ttcaccaaag agaaaattgg
     1081 caaaatgctg tcctcagcag cgtcaacgct cagggcttgc aaagaccttg gtgcctacgg
     1141 tttagagata ctcaaattag tcatgaaatg gtttttccca aagaaagaag aagccaatga
     1201 actagccatg gtgagagcaa tagaggatgc tgttctggat cttgaggcga tagaaaacaa
     1261 tcacatgaca gccctgctga aagataaaga cagccttgca acctacatga aaacactgga
     1321 tctagaggag gagaaagcca gaaaactgtc cacgaaatct gcatcccctg acatagttgg
     1381 gacaatcaac gccctactgg ctcgaatagc ggcggctaga tcactagtcc acagggccaa
     1441 ggaggagcta tctagcagaa tcagaccagt tgtcgttatg atatctggca agccagggat
     1501 aggcaagacc cacttggcca gggaggtggc gaaaaaggtg gcgtccactc tcacaggaga
     1561 tcaaagagtt ggactcatac cgagaaacgg tgtggaccat tgggatgcat acaaaggtga
     1621 aagagtcgtg ttgtgggatg actatggcat gagcaaccct attcatgatg cactgcgcat
     1681 acaggaattg gccgacacat gccccctcac cttgaattgt gacagaattg aaaataaggg
     1741 gaaagttttt gatagtgatg ttataataat tacaacaaac cttgccaacc cagctcctct
     1801 tgattatgtc aactttgaag cctgttccag gagaattgac ttcctggtgt acgccgaagc
     1861 gccagaagtg gaaaaggcaa aacgggattt ccctggtcaa ccagatatgt ggaaggacgc
     1921 cttcaaagcg gacttctcgc acatcaagtt gcaacttgcg cctcagggcg gctttgacaa
     1981 gaatggcaac accccacatg ggaaaggagt gatgaagacc cttaccaccg gttctctgat
     2041 cgcccgtgcg tcaggtttgc tacatgagag gatggatgaa tttgaacttc agggccccgc
     2101 aatcaccact ttcaactttg accggaacag agtcaccgct ttcagacaac tggctgctga
     2161 gaacaaatat gggctggtgg acaccatgag gattggcaat caattgaaag gggtgaaaac
     2221 catggaagaa ctcaagcaag ctatcaagaa tgtgtccatc aagaggtgcc agattatcta
     2281 ccatggatcc acgtttgacc ttgagtctga tggtaagggt aaagttacag tagaaaaggt
     2341 caaaaacacc actgttcaga ccaacaacga attggccgga gccctgcacc acctcagaag
     2401 tgctcgaatc aggtattatg tcaaatgtgt gcaagaggca atctattcca tcctacaaat
     2461 tgccggcgcc gcgttcgtca ccacacgcat tgcacgccgc atgaatatac aagagctttg
     2521 gtcaaagcca ccattagacc aaagcgagcc agaggttaag gaggagaccc ccaagttaga
     2581 ggatgatgaa ttcatcattt cctccaagga cattaaggag gaagggaaga agggtaaaaa
     2641 caaaactggc cgtggcaaga aacacactgc attctctagc aagggcttga gcgatgagga
     2701 gtatgacgag tacaagagga taagagaaga gagaaatggg aagtactcta tagaggagta
     2761 tcttcaagac agggacaggt actatgaaga actcgccatc gccaaggcca cggaagaaga
     2821 cttttgtgag gaggaagaaa taaaaatccg ccaacggatc tttcgtccca ctagaaaaca
     2881 aaggaaggaa gaaagggcca cgttagggct agtgactggt tcagaaatca gaaaaagaaa
     2941 ccctgatgac ttcaaaccta aagggaaatt gtgggccgac gacaacagaa gtgttgacta
     3001 caatgaaaaa ctggactttg aggccccccc aagcatatgg tctaggatcg taagctttgg
     3061 ttcaggttgg ggcttctggg tgtcaccaag cctgtttata acatcaactc atgtgatccc
     3121 ttcgggcata acagaggcat ttggagtccc catcaaacag attcaagtcc acaaatcagg
     3181 cgagttttgt cggctcagat tcccaaaacc aattagacca gatgtaacag gaatgatcct
     3241 ggaagaaggt gcgccagagg gcaccgtagc aaccgtactc atcaagcgcc ccactggaga
     3301 actcatgccc ctcgcagcta gaatgggaac acacgcaacc atgaaaattc agggccgcat
     3361 ggttggtggg cagatgggca tgttgctcac tggttcaaat gctaagggta tggatctggg
     3421 gacaactccc ggtgactgtg gctgcccgta catttacaaa aggggcaatg actacatagt
     3481 cattggagtg cacacagcag cagcccgagg tggaaatact gtcatctgtg ccacacaggg
     3541 aagtgagggc gaggcgaccc tcgagggtgg agacgacaaa ggaacatact gtggggcacc
     3601 catcctgggc cctggagggg cgccaaagtt aagcacaaaa accaaatttt ggaggtcatc
     3661 aaacacgccc cttccaccag ggacatatga gcctgcctac cttggcggtc gtgatccgcg
     3721 tgtaaagggt gggccttccc tacaacaagt catgagagat cagttaaagc ccttcaccga
     3781 gcccaggggt aaacccccga gacctagtgt actggaggca gccaaacaga ccatcatcaa
     3841 cgttctcgag caaactttgg accctccaca aaaatggacg tacgcacagg cgtgcgcttc
     3901 acttgataaa accacctcta gtgggcaccc ccatcacgct cgaaagaatg agttctggaa
     3961 cggtgagacc tttaccggta agttggcaga ccaggcatca aaagcaaact taatgtttga
     4021 ggaagggaaa catatgacac cagtatacac agcagccctt aaggatgagt tagttaaaac
     4081 cgacaaaatc tatgggaaga tcaagaaacg cctgctttgg ggctctgatt tatccaccat
     4141 ggtccgatgt gccagggcct ttggtggact catggacgag atgaaggcgc actgcatatc
     4201 gctcccaatc cgagttggca tgaatatgaa tgaggatggt ccaataatat ttgagaagca
     4261 ctccagatat aaatatcact atgatgcaga ttactctcgc tgggactcaa cacaacagag
     4321 agctgttcta gcagcggcct tggaaataat ggtcagattc tctgcagaac cgcaactggc
     4381 ccaaacagtt gctgaggatc tgctggcccc cagtgtagta gatgtcggag acttcaaaat
     4441 ttcaataaat gagggactcc cttctggtgt accatgcact tcccaatgga actccatctc
     4501 acactggtta ctaactctct gtgctttgtc tgaagtcacc aatctgtctc ctgacatcgt
     4561 gcaggtaaat tctatgttct cattttacgg tgatgacgag atcgtcagca ccgatataaa
     4621 attggaccct gaaaagttaa ccaccaaatt gagggagtat ggtctaaaac caactcgccc
     4681 agacaaaacc gaggggccct tgatcatcag tgaggatttg gacggtctca ccttcctccg
     4741 gaggacggtt tctcgtgacc cagccggttg gtttggaaag ttagatcaaa gctcaatact
     4801 aaggcagatg tattggacca gaggaccaaa ccatgaagac cccaatgaga caatgatacc
     4861 ccactctcaa agacccatac agctcatggc actgcttggt gaggcctccc ttcacggacc
     4921 ctctttctac agcaagatta gtaaattggt cataactgaa ctcaaagaag gtgggatgga
     4981 cttttacgtg ccaagacagg aacccatgtt cagatggatg aggttttctg acttgagcac
     5041 gtgggagggc gatcgcaatc tggctcccag ttttgtgaat gaagatggcg tcgaatgacg
     5101 ccgctccatc tactgatggt gcagccggcc tcgtgccaga aagtaataat gaggtcatgg
     5161 ctcttgaacc cgtggctggt gccgccttgg cagccccagt caccggtcaa acaaatataa
     5221 tagacccttg gattagagca aattttgtcc aggcccccaa tggtgaattt acagtctctc
     5281 cccgtaactc ccctggtgaa gtgctattga atctagagtt gggtccagaa ttaaatcctt
     5341 atctggcaca tttagcaaga atgtacaatg ggtatgccgg tgggatggag gtgcaggtca
     5401 tgttggctgg gaacgcgttc acagccggca agttagtctt cgccgctgtg ccaccccact
     5461 tcccggtcga aaaccttagc ccacagcaaa ttaccatgtt ccctcatgtg attatagatg
     5521 tcaggacttt ggaacctgtt ttattaccac tccctgatgt tagaaataac ttcttccatt
     5581 acaatcagaa agatgatccc aagatgagaa ttgtggctat gctttatacc ccccttaggt
     5641 ctaatggttc aggcgatgat gtgtttacag tctcctgcag ggtgttgact agaccctccc
     5701 ctgattttga tttcacatat ctggtgccac caacagtgga atctaaaaca aaaccattca
     5761 ctctcccaat cctcacgctt ggggaacttt ccaattctag attcccagtg tccatagatc
     5821 agatgtacac cagccccaat gaagtcatat cagtacagtg tcaaaatggc aggtgcacac
     5881 tggatgggga actccaagga acaacacaac tccaagtcag tggcatttgt gctttcaagg
     5941 gagaagtgac tgcccacttg catgacaatg atcacctgta taatgtcacc atcacaaact
     6001 tgaatgggtc cccttttgac ccctccgagg acatccccgc ccctctgggc gtacctgatt
     6061 ttcagggaag ggtctttggt gtcatctccc aaagagacaa acacaatacc cctggacata
     6121 atgaaccagc aaacagggca cacgatgccg tggtccctac ttatacagca cagtataccc
     6181 caaaattggg tcagattcaa attggcacat ggcagactga cgatctcaca gtcaaccaac
     6241 cagtcaaatt caccccagtt ggacttaatg acactgacca ttttaaccaa tgggtggtcc
     6301 ccaggtatgc tggtgcccta aaccttaaca caaaccttgc cccttctgtt gctccagtat
     6361 ttccagggga gcgtctgctc tttttcagat catacatccc cctcaagggt ggctatggaa
     6421 ctccagccat cgattgccta ctaccacaag agtgggtgca acatttctat caggaagcag
     6481 ccccttcgat gagtgaggtg gcccttgtca gatacatcaa cccggatact ggtcgggcac
     6541 tgtttgaggc caaactccat agagctggtt tcatgacagt ctcaagcaac accagtgccc
     6601 cggtggttgt gcctgccaac ggatacttca ggtttgattc ttgggtgaac caattctatt
     6661 ctctcgcccc catgggaact ggaaatgggc gcagaagggt ccaataatgg ctggagcttt
     6721 tgtagctggt cttgcagggg acgtgctcag caatgggctc agttcattaa ttaatgcagg
     6781 tgctaatgca ataaatcaga gggcagaatt tgatttcaat cagagattac agcaaaattc
     6841 tttcaatcat gataaggaga tgttgcaggc ccagatccag gcaactaagc agctgcaggc
     6901 agatatgatg gctataaaac agggggtcct agctgctggc ggcttttccc ctgctgatgc
     6961 agccagaggt gctgtgaacg cgcccatgac acaggcgctg gactggaacg gcacaaggta
     7021 ctgggcacca ggctccatga ggactacagc ctactctggg agattcacat caaccgcccc
     7081 agtgaggcag gccgattttc agcacaccca aagccggcct tcgagtggtt cttctgtgtc
     7141 ctcctttgct actcagtctt caaggccgac cctgactaca accactgggt cctcatatgg
     7201 cacaacctca tcaaattcga ctcgcagcac aaacctctcc caatcaacgg tctccagggc
     7261 tacatctagg actggtgaat gggttagaga ccaaaacaga aatttggaac cttacatgca
     7321 tggtgcctta cagacagcct ttgtcactcc accttccagc agggcgtctg atgggacggt
     7381 ctcaaccgtt ccaaaaggtg ttttggactc ctggacacct gcgtttaaca cccgcaggca
     7441 gccgcttttc gcacacctcc gtaagagggg ggagtcacaa gcttagtgaa aaggtgaaaa
     7501 tttatttaaa atgaattgat ttttaccttt t
//