Typing tool

Complete norovirus genomes

LC209439  GII.2
 GII.P31

Length: 7,536 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       LC209439                7536 bp    RNA     linear   VRL 14-DEC-2017
DEFINITION  Norovirus Hu/GII/JP/2014/GII.Pe_GII.2/Saitama-127 RNA, complete
            genome.
ACCESSION   LC209439
VERSION     LC209439.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/JP/2014/GII.Pe_GII.2/Saitama-127
  ORGANISM  Norovirus Hu/GII/JP/2014/GII.Pe_GII.2/Saitama-127
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Mizukoshi,F., Nagasawa,K., Doan,Y.H., Haga,K., Yoshizumi,S.,
            Ueki,Y., Shinohara,M., Ishikawa,M., Sakon,N., Shigemoto,N.,
            Okamoto-Nakagawa,R., Ochi,A., Murakami,K., Ryo,A., Suzuki,Y.,
            Katayama,K. and Kimura,H.
  TITLE     Molecular Evolution of the RNA-Dependent RNA Polymerase and Capsid
            Genes of Human Norovirus Genotype GII.2 in Japan during 2004-2015
  JOURNAL   Front Microbiol 8, 705 (2017)
   PUBMED   28487679
  REMARK    DOI:10.3389/fmicb.2017.00705
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Mizukoshi,F., Matsushima,Y., Ishikawa,M. and Kimura,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2017) Contact:Mariko Ishikawa Kawasaki City
            Institute for Public Health, Division of Virology; Tonomachi
            3-25-13, Kawasaki-ku, Kawasaki, Kanagawa 210-0821, Japan
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus
                     Hu/GII/JP/2014/GII.Pe_GII.2/Saitama-127"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII/JP/2014/GII.Pe_GII.2/Saitama-127"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:1934265"
                     /country="Japan: Saitama"
                     /collection_date="2014"
                     /note="genotype: GII.Pe_GII.2"
     gene            5..5104
                     /gene="POL"
     CDS             5..5104
                     /gene="POL"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="BBB86935.1"
                     /translation="MKMASNDASAAAAANSNNDIAKSSSDGMLSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVSQPE
                     ENNTAFSVPPLNQRENRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFPGIVESLILLAELFGVFWTPPDVSAMITPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRLRPVVVMISGKPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLMDTMRVGKQLKDVKTM
                     PDLKQALKNVAIKKCQIVYSGSTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEETASRDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLI
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFYGVPVKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHIRKNDYW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6713
                     /gene="VP1"
     CDS             5085..6713
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="BBB86936.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPIESLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPAKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPV
                     IDCLLPQEWVQHFYQEAAPAMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7492
                     /gene="VP2"
     CDS             6713..7492
                     /gene="VP2"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="BBB86937.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQRLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGRFTSTAPVRQADFQHTQSRPSSGSSVSSFTTQSSRPTLTTTT
                     GSSHGTVSSNLTRSTNLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgccaaca gcaacaacga
       61 catcgcaaaa tcttcaagtg acggtatgct ttctaacatg gctgtcactt ttaaacgggc
      121 cctcggggcg cggcctaaac agccgccccc gaaggaaata ccacccagac ccccacgacc
      181 acccacacca gaattggtta aaaagatccc tcctcctcca cccaacgggg aggatgaact
      241 agtggtttct tacagcgcca aagacggcgt ttccggattg cctgagctca ccactgtcag
      301 ccaaccggaa gaaaacaaca cggcgttcag tgttccccca ctcaaccaaa gggagaacag
      361 ggacgccaag gaaccactaa ctggaacaat cattgaaatg tgggatggag aaatctacca
      421 ttacggcctg tacgtagaac ggggtcttat acttggtgtg cataagccac cggcagccat
      481 cagccttgcc aaggtcgagc tgacaccact ctctttgttc tggagacctg tgtatacccc
      541 ccagtacctc atctctccag acactcttag gagactacat ggagaatcat tcccctacac
      601 cgcatttgac aacaattgct acgccttctg ctgttgggta ttagacctaa acgactcatg
      661 gttaagtagg agaatgattc agagaacaac aggtttcttc agaccatacc aggaatggaa
      721 caggaaaccc ctccccacta tggatgattc caaattgaag aaggtagcca acatattctt
      781 gtgcaccttg tcttcactat tcaccagacc cattaaggac ataataggaa aattgaaacc
      841 tcttaatatc ctcaatattc tggctacatg tgattggacc ttcccaggca tagtggaatc
      901 cctaatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcaccccc ttactaggtg attatgaact gcaaggacct gaggaccttg cagtggaact
     1021 ggtcccagtg gtgatggggg ggataggttt ggtgctagga tttaccaaag agaaaattgg
     1081 aaagatgctg tcgtccgctg catccacttt gagagcttgt aaagaccttg gtgcatacgg
     1141 actggaaatt ctgaaattag tcatgaaatg gttcttccca aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggacgc agtgctggac ctcgaggcaa ttgaaaacaa
     1261 ccacatgacc accttgctca aagacaaaga cagcttggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcta gaaaactctc aaccaaatct gcttcacctg atattgtggg
     1381 cacaatcaac gctctcctgg cacgaatcgc cgctgcacgc tccctagtgc atcgggcgaa
     1441 agaagaactc tccagcaggc tgagacctgt cgttgtgatg atatcgggaa aaccagggat
     1501 agggaaaact caccttgcta gggagttggc caagaggatc gcagcctctc tcacagggga
     1561 ccagcgtgtg ggtctgatcc cacgcaatgg cgtcgaccac tgggacgcat acaagggtga
     1621 aagagttgtc ctatgggacg actatgggat gagcaacccc atacacgatg ccctcaggtt
     1681 gcaggaactt gctgacactt gccccctcac gctaaattgt gacaggattg agaacaaagg
     1741 aaaagtcttt gacagtgatg ccataattat caccaccaat ttggccaacc cagcaccact
     1801 ggattatgtc aattttgaag catgctcgag gcgcattgac ttcctcgtgt acgcggaagc
     1861 tcctgaggtg gaaaaggcga aacgcgactt cccaggccaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gacttctcac acataaaact ggcattggct ccacagggtg gttttgacaa
     1981 gaacggcaac accccgcatg gaaaaggtgt catgaaaacc ctcaccactg gctccctcat
     2041 cgcccgagca tcaggattac tccatgagag gctagatgaa tatgaattac aaggcccagc
     2101 cctcaccact tttaactttg accgcaacaa gatacttgcg tttagacagc ttgctgctga
     2161 aaacaagtac gggctaatgg acacaatgag agttggaaaa cagctcaagg atgtcaagac
     2221 catgccagac ctcaaacaag cactcaagaa tgtcgcgatc aagaagtgcc agatagtgta
     2281 cagtggtagc acctacacac ttgaggccga tggcaagggt agtgtgaaag ttgataaagt
     2341 gcaaagtgcc accgtgcaaa ccaacaatga actagctggc gccctacacc acctaaggtg
     2401 cgccagaatc agatactatg ttaagtgtgt ccaggaggca ctgtattcca tcatccaaat
     2461 cgctggggct gcgttcgtca ccacgcgcat cgccaagcga atgaacatac aaaatctctg
     2521 gtccaagcca caggtggaag acacagaaga gacggccagc agagatggtt gcccaaaacc
     2581 caaagatgat gaagagttcg tcgtttcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaaaaacaag tccggccgtg gcaagaagca cacagccttc tcaagcaaag ggctcagtga
     2701 tgaggagtac gatgagtaca agaggattag agaagaaagg aatggcaagt actccataga
     2761 agagtacctc caggacagag acaagtacta tgaggaggtg gccattgcca gggcaactga
     2821 agaggacttc tgtgaagaag aagaggccaa aatccggcag agaattttca gaccaacaag
     2881 gaaacaacgt aaagaagaga gggcctctct aggcttgatc acaggctcag aaatcaggaa
     2941 gagaaaccca gaagacttca aacccaaggg aaagctgtgg gctgatgatg acagaagtgt
     3001 tgactacaac gagaaactca actttgaagc cccaccaagc atttggtcgc ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtctc ccccagtttg tttataacat caacccatgt
     3121 cataccccaa ggagcaaaag agttctacgg agtccccgtc aaacaaatcc agatacacaa
     3181 atcaggtgaa ttctgccgat tgagattccc aaaaccaatc agaactgatg tgacgggtat
     3241 gattctggaa gaaggtgcgc cagaaggaac cgtggccaca ctgctcatca agagaccaac
     3301 tggagagctc atgcctttgg cagccagaat ggggacccat gcaaccatga agattcaggg
     3361 gcgcacagtt ggaggacaaa tgggtatgct cttgacagga tccaacgcca agagtatgga
     3421 cttgggcaca acaccaggcg actgcggctg tccctacatc tacaaaagag ggaatgacta
     3481 cgtggtcata ggagtccata cagccgctgc ccgcggagga aacactgtca tctgtgccac
     3541 ccagggcagt gagggagaag ccacacttga aggaggtgac aacaaaggaa cgtactgtgg
     3601 cgcaccaatc ttgggcccag ggagtgctcc gaaactcagt accaagacta agttttggag
     3661 atcatccaca acgccactcc caccaggcac ctacgaacca gcctacctcg gtggcaagga
     3721 tcccagagtc aaaggtggcc cttcattgca acaagttatg agggaccagc taaagccatt
     3781 cacagaaccc agaggcaagc caccaagacc aaatgtgttg gaagctgcca agaaaaccat
     3841 cattaatgtt cttgagcaaa caattgaccc accccaaaaa tggtcattcg cgcaagcttg
     3901 cgcatccctt gacaaaacca cctccagcgg ccatccgcac cacatacgga aaaatgatta
     3961 ctggaatggg gagtccttta caggaaaatt ggcagatcag gcctccaagg ccaacctaat
     4021 gtttgaagag ggaaagaaca tgactccagt ctacacaggt gcactaaaag atgaattggt
     4081 aaaaactgac aaaatttatg gtaagatcaa gaagaggctc ctgtggggct cggacctggc
     4141 gaccatgata cggtgcgccc gagcttttgg aggccttatg gatgaactca aggcacactg
     4201 tgtcaccctc cctgtcagag ttggtatgaa catgaatgaa gatggcccca taatctttga
     4261 gaagcactcc agatacaggt atcactatga tgctgattac tccaggtggg attcaacaca
     4321 acaaagggat gtgctagcag cagcactaga aatcatggtt aagttctctc cagaaccaca
     4381 cttggcccag atagttgcag aagacctcct ttcccctagt gtaatggatg tgggtgactt
     4441 tcaaatatca ataagtgagg gactcccctc cggggtacct tgcacctccc agtggaattc
     4501 catcgcccac tggctcctca ccctttgtgc actctctgaa gtcacggacc tgtcccctga
     4561 catcattcag gccaactccc ttttctcctt ctatggtgat gatgagattg tgagtacaga
     4621 tataaagttg gacccagaga agctaacagc aaaactcaag gagtacgggc tgaagccaac
     4681 ccgccccgat aaaactgaag gaccccttgt tatctccgaa gatctggatg gcctgacatt
     4741 cctccggagg actgtgactc gtgacccagc tggctggttt ggaaaattgg aacaaagctc
     4801 gattctcagg caaatgtact ggaccagggg tcccaaccat gaagatccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt gatgtccttg ctgggcgagg ctgcactcca
     4921 cggcccagca ttttacagca aaattagcaa attggtcatt gcagaattga aggaaggcgg
     4981 catggatttc tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aataatgagg
     5161 tcatggctct tgaacccgtg gctggtgctg ccttggcagc cccggtcact ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccctaatggt gaatttacag
     5281 tttccccccg taatgcccct ggtgaagtgc ttttgaatct agagttgggt ccagagttaa
     5341 atccttacct ggcacattta gcaagaatgt acaatgggta tgccggtggg atggaggtgc
     5401 aggtcatgtt ggctgggaac gcgttcacag ccggtaagtt ggtcttcgcc gccgtgccac
     5461 ctcacttccc gattgaaagc ctaagtccac agcaaattac catgtttccc catgtgatta
     5521 tagatgtgag aactttggaa cctgttttat taccactccc tgatgtcaga aataatttct
     5581 ttcattataa tcagaaagat gatcccaaga tgagaattgt ggctatgctt tatacccccc
     5641 ttaggtctaa tggctcaggt gatgatgtgt ttacagtctc atgcagggtg ttgactagac
     5701 cctcccctga ttttgatttt acatatttgg tgccaccaac agtggaatct aaaacaaagc
     5761 cattcaccct cccaatcctc acgcttgggg aactctccaa ttctagattt ccagtgtcca
     5821 tagaccagat gtacaccagc cccaatgaag ttatatcagt gcaatgtcaa aatggtaggt
     5881 gcacactaga tggggaactc caaggaacaa cacaacttca agtcagtggc atttgtgctt
     5941 tcaagggaga ggtgaccgcc cacttgcatg acaatgacca cctatataat gtcaccatca
     6001 caaacttgaa cgggtcccct tttgacccct ccgaggacat ccctgcccct ctgggtgtac
     6061 ctgattttca gggaagggtc tttggtatca tctcccagag agacaaacat aacagtcctg
     6121 gacataatga accagcaaac aggggacacg acgccgtggt ccctacttac acagcacagt
     6181 acaccccaaa attgggtcaa attcaaattg gcacatggca gaccgatgat cttacagtca
     6241 accaaccagc caagtttacc ccagttggac tcaatgacac tgaacatttt aaccaatggg
     6301 tggtccccag atatgctggt gctctaaatc tcaatacaaa tcttgcccct tctgttgctc
     6361 cagtgttccc aggggagcgc ctgctctttt tcagatcata tattcccctc aagggtggtt
     6421 atggaaatcc agttattgat tgcctgctac cacaagagtg ggtgcaacat ttctatcagg
     6481 aagcagcccc tgcaatgagt gaggtggccc ttgtcaggta catcaacccg gacactggtc
     6541 gagcactgtt tgaggccaag ctccacagag ctggtttcat gacggtctcg agcaacacca
     6601 gtgccccggt ggtcgtgcct gcaaacggat acttcagatt tgattcttgg gtgaatcaat
     6661 tctattctct cgcccccatg ggaactggaa atgggcgtag aagggttcaa taatggctgg
     6721 agcttttgta gctggtcttg caggggacgt gctcagcaat gggctcagtt cactaattaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaatcaga gattacagca
     6841 aaattctttc aatcatgata aggagatgtt acaggctcag attcaggcaa ctaagcagct
     6901 gcaggcagac atgatggcta taaagcaggg ggtcttgacc gctggcggct tctcccctgc
     6961 tgacgcagcc agaggtgctg tgaatgcgcc catgacacag gcgctagatt ggaacggcac
     7021 caggtattgg gcaccaggct ccatgaggac cacatcttac tctggaagat ttacatcaac
     7081 cgccccagtg aggcaggccg acttccagca tacccagagc cggccttcga gtggctcttc
     7141 tgtgtcctcc ttcactactc agtcttcaag gccaactctg actacaacta ctgggtcctc
     7201 acatggcaca gtttcatcaa atttgactcg cagcacaaac ctctcccaat caacagtttc
     7261 tagggccaca tctaggacag gtgagtgggt tagagatcaa aatagaaatt tggaacctta
     7321 catgcatggt gccttacaga cagcctttgt caccccacct tccagcaggg cgtctgatgg
     7381 gacagtctca accgtcccaa aaggtgtttt ggactcctgg acacctgcgt tcaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagcct agtgaaaagg
     7501 tgaaaattta tttaaaatga attgatttta tctttt
//