Typing tool

Complete norovirus genomes

LC066046  GII.4 Sydney
 GII.P31

Length: 7,545 | 3 CDS

ORF1: 4..5094
ORF2: 5075..6697
ORF3: 6697..7503
LOCUS       LC066046                7545 bp    RNA     linear   VRL 01-AUG-2015
DEFINITION  Norovirus Hu/GII/JP/2015/GII.Pe_GII.4/Osaka/OSF78 POL, VP1, VP2
            genes for nonstructural polyprotein, capsid protein VP1, capsid
            protein VP2, complete cds.
ACCESSION   LC066046
VERSION     LC066046.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII/JP/2015/GII.Pe_GII.4/Osaka/OSF78
  ORGANISM  Norovirus Hu/GII/JP/2015/GII.Pe_GII.4/Osaka/OSF78
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sakon,N., Komano,J., Miyazaki,Y., Nakata,K., Yumisashi,T. and
            Kumeda,Y.
  TITLE     Norovirus variant 2012 sydney caused food-borne outbreak in the
            dormitory of high school
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7545)
  AUTHORS   Sakon,N., Nakata,K., Miyazaki,Y., Yumisashi,T., Kumeda,Y.,
            Nakamura,S. and Motooka,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUL-2015) Contact:Naomi Sakon Osaka Prefectural
            Institute of Public Health, Infectious Diseases; 1-3-69 Nakamichi,
            Higashinari-ku, Osaka, Osaka 537-0025, Japan URL
            :http://www.iph.pref.osaka.jp/
COMMENT     On Aug 1, 2015 this sequence version replaced LC066046.1.
            
            ##Genome-Assembly-Data-START##
            Assembly Method      :: CLC Genomics Workbench v. 8.0
            Sequencing Technolog :: illumina Miseq
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7545
                     /organism="Norovirus
                     Hu/GII/JP/2015/GII.Pe_GII.4/Osaka/OSF78"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII/JP/2015/GII.Pe_GII.4/Osaka/OSF78"
                     /host="Homo sapiens"
                     /db_xref="taxon:1682363"
                     /country="Japan"
                     /collection_date="2015-06-13"
     gene            4..5094
                     /gene="POL"
     CDS             4..5094
                     /gene="POL"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="BAS02082.2"
                     /translation="MKMVASDVAVANSNNDIAKSSSDGVFSNMAVTFKRALGARPKQP
                     PPKEIPPKPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPEETN
                     TAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAISLAK
                     VELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDSWLS
                     RRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGKLKP
                     LNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPEDLAV
                     ELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFPKKE
                     EANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLSTKSA
                     SPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLARELAKK
                     IAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTCPLT
                     LNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEKAKR
                     DFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARASGL
                     LHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLVDTMRVGKQLKDVKTMSDL
                     KQALKNIAIKKCQIVYNGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLRCAR
                     IRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQDLWSKPQVEDTEEMANKDGCLKP
                     KDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKYS
                     IEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLVTGS
                     EIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSPSLF
                     ITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEGTVA
                     TLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGDCGC
                     PYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILGPGS
                     APKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGK
                     PPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCWNGE
                     SFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSDLATM
                     IRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWDSTQ
                     QRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQITISEGLPSGVPCTSQW
                     NSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYG
                     LKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHE
                     DPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMF
                     RWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5075..6697
                     /gene="VP1"
     CDS             5075..6697
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="BAS02083.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHTTGSHNYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTNHDFEANQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNTPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     gene            6697..7503
                     /gene="VP2"
     CDS             6697..7503
                     /gene="VP2"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="BAS02084.2"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWNGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSS
                     NSSTATSVYSNQTISTRLGSTAGSGTSVSSFPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPREILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 tgaatgaaga tggtcgcttc cgatgtcgct gttgccaaca gcaacaacga catcgcaaaa
       61 tcttcaagtg acggtgtgtt ttctaacatg gctgtcactt ttaagcgggc cctcggggcg
      121 cggcctaaac agccgccccc gaaggaaata ccacccaaac ccccgcgacc acccacacca
      181 gaattggtca aaaagatccc tcctccccca cccaacgggg aggatgaact agtggtctct
      241 tacagcgcca aagatggcgt ttccggactg cctgagctca ccactgtcag acaaccggaa
      301 gaaaccaaca cggcgttcag tgtcccccca ctcaaccaaa gggagagcag ggacgccaag
      361 gagccactaa ctggaacaat cattgaaatg tgggatggag aaatctacca ttacggcctg
      421 tacgtggaac gaggtcttat acttggtgtg cacaagccac cagcagccat cagcctcgcc
      481 aaggtcgagc tggcaccgct ctctttgttc tggagacctg tatacacccc ccagtacctc
      541 atctctccag acactcttag gagattacat ggagagtcat tcccctacac tgcatttgac
      601 aacaattgct acgctttttg ttgttgggta ttagacctaa acgactcatg gctaagcagg
      661 agaatgattc agagaacaac aggcttcttc aggccgtacc aggattggaa caggaaaccc
      721 ctccccacta tggatgattc caaattgaag aaggtagcca acatattctt gtgcactttg
      781 tcttcactat tcaccagacc cattaaggac ataataggga agttgaaacc tctcaacatc
      841 cttaatattc tggctacatg tgattggacc ttcgcaggca tagtggaatc cttaatactc
      901 ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat gatcgccccc
      961 ttgctaggtg attatgaact gcaaggacct gaggaccttg cagtggaact ggtcccaata
     1021 gtgatggggg ggataggttt ggtgctagga tttaccaaag agaaaatcgg aaagatgctg
     1081 tcatccgctg catccacttt aagagcttgt aaagaccttg gtgcatacgg actggaaatc
     1141 ttaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga actggctatg
     1201 gtgagatcca tcgaggatgc agtactagac ctcgaggcaa ttgaaaacaa ccacatgacc
     1261 accctgctca aagacaaaga cagcttggca acctacatga gaacccttga ccttgaggag
     1321 gagaaagcca gaaaactctc aaccaaatct gcttcacccg atattgtggg cacaatcaac
     1381 tctcttctgg caagaatcgc tgctgcacgc tccctagtgc atcgggcaaa agaagagctc
     1441 tccagcaggc cgagacctgt cgttgtaatg atatcgggaa gaccagggat agggaaaact
     1501 caccttgcca gggagctggc caagaagatc gcggcctccc tcacagggga ccagcgtgtg
     1561 ggtcttatcc cacgcaatgg tgtcgaccac tgggacgcat acaagggcga aagagttgtc
     1621 ctatgggacg actatggaat gagcaacccc atccatgatg ccctcaggtt gcaggagctt
     1681 gctgacactt gccccctcac gctaaattgc gacagaattg agaacaaagg aaaagtcttt
     1741 gacagtgatg ccataattat caccaccaac ctggccaacc cagcaccact ggattatgtc
     1801 aactttgaag cgtgctcgag acgcattgat ttcctcgtgt acgcagaagc ccctgaggtg
     1861 gagaaggcaa agcgcgactt cccaggtcaa cctgacatgt ggaagaacgc tttcagtcct
     1921 gacttctcac acataaaact gtcattggct ccacagggtg gttttgacaa gaacggcaac
     1981 accccgcatg gaaaaggggt catgaaaacc ctcaccactg gctccctcat cgcccgagca
     2041 tcagggttac tccatgagag gctagatgaa tatgaattgc aaggcccagc cctcaccact
     2101 ttcaactttg accgcaacaa gatacttgct tttagacagc ttgctgctga aaacaagtat
     2161 gggctggtgg acacaatgag agttggaaaa cagctcaagg atgtcaagac catgtcagac
     2221 ctcaaacaag cactcaagaa catcgcgatc aagaagtgcc agatagtgta caatggtggc
     2281 acctacacac ttgaggctga tggcaagggt agtgtgaaag ttgacaaagt gcaaagtgcc
     2341 actgtgcaga ccaacaatga actagccggt gccctacacc acctaaggtg cgctagaatc
     2401 agatactatg ttaagtgcgt ccaggaggca ctgtattcca tcatccaaat cgctggggct
     2461 gcattcgtca ccacgcgcat cgctaagcgc atgaatatac aggatctctg gtccaagcca
     2521 caggtggaag acacagaaga gatggccaac aaagatggtt gcctaaaacc caaagatgat
     2581 gaagagtttg tcgtctcatc cgacgacatc aaaactgagg gcaagaaagg gaagaacaag
     2641 tccggccgtg gcaagaagca cacagccttt tcaagtaaag ggctcagtga tgaggagtac
     2701 gatgagtaca agagaatcag agaagaaagg aatggtaagt actccataga ggagtacctt
     2761 caggacagag acaggtacta cgaggaggtg gccattgcca gggcaaccga agaggacttc
     2821 tgtgaagaag aagaggccaa aatccggcag agaattttca gaccaacaag gaaacaacgc
     2881 aaagaagaga gggcctctct cggcttggtc acaggctctg aaatcaggaa gagaaaccca
     2941 gaagacttca aacccaaggg aaagctgtgg gctgatgatg acagaagtgt tgactacaat
     3001 gagaaactca actttgaggc cccaccaagc atctggtcgc ggatagtcaa ctttggttca
     3061 ggctggggct tctgggtctc ccccagtctg tttataacat caacccatgt cataccccaa
     3121 ggtgcaaaag agttcttcgg agtccctatc aagcaaatcc agatacacaa gtcaggtgaa
     3181 ttctgccggt tgagattccc aaagccaatc agaaccgatg tgacgggcat gattctagaa
     3241 gaaggtgcgc ccgaggggac cgtggccaca ctgctcatca agagaccaac tggagagctc
     3301 atgcctctgg cagccagaat ggggacccat gcaaccatga aaattcaggg gcgcacagtt
     3361 ggagggcaaa tgggtatgct cctgacagga tccaacgcca agagtatgga cctaggcaca
     3421 acaccaggcg actgcggctg cccctacatc tacaagaggg ggaatgacta cgtggtcata
     3481 ggagtccata cggccgctgc ccgtggagga aacactgtca tatgtgccac ccagggaagt
     3541 gagggagagg ccacacttga aggaggtgac agtaaaggga catactgtgg cgcaccaatc
     3601 ttgggcccag ggagcgctcc gaagctcagc accaagacta agttttggag atcatccaca
     3661 acaccactcc cacctggcac ctacgaacca gcctacctcg gtggcaaaga ccctagagtc
     3721 aaaggtggcc cttcattgca acaagttatg agggaccagc tgaagccatt cacagaaccc
     3781 agaggcaaac caccaagacc aaatgtgttg gaagctgcca agaaaaccat catcaatgtc
     3841 cttgagcaaa caattgatcc accccaaaaa tggtcatttg cgcaagcttg cgcatccctt
     3901 gacaaaacca cctccagcgg ccacccgcac catatgcgga aaaacgactg ttggaatggg
     3961 gagtccttca caggaaaatt ggctgatcaa gcctccaagg ccaacctaat gtttgaagag
     4021 ggaaagaaca tgactccagt ctacacaggt gcacttaaag atgagttggt aaagaccgat
     4081 aaagtttatg gtaaggtcaa gaagaggctt ctgtggggtt cagatctggc gaccatgata
     4141 cggtgcgccc gagcttttgg aggcctcatg gatgaactca aggcacactg tgtcacactc
     4201 cctgtcagag ttggtatgaa catgaatgag gatggcccca tcatcttcga gaagcactcc
     4261 agatatagat atcactatga tgctgactat tcccggtggg actcaacaca acaaagggat
     4321 gtgctagcag cagcactaga aatcatggtt aagttctctc cagaaccaca cctggcccag
     4381 atagttgcag aagacctcct ctcccctagc gtgatggatg taggtgactt tcaaataaca
     4441 ataagtgagg gtctcccctc tggggtgcct tgtacctccc agtggaattc catcgcccac
     4501 tggctcctca ctctgtgtgc actctctgaa gtcacggacc tgtcccctga tatcattcag
     4561 gccaactccc ttttctcctt ctatggtgat gatgagattg taagcacaga cataaagttg
     4621 gacccagaga agctgacagc aaaactcaag gagtacgggc tgaaaccaac ccgccccgac
     4681 aaaactgaag gaccccttgt tatctctgaa gacctggatg gtctgacatt cctccggaga
     4741 actgtgaccc gtgatccagc tggctggttt ggaaaattgg aacaaagttc aattcttagg
     4801 caaatgtact ggaccagggg tcccaaccat gaagatccat ttgaaacaat gataccacac
     4861 tcccaaagac ccatacaatt gatgtccttg ctgggcgagg ctgcactcca cggcccggca
     4921 ttctacagca aaattagcaa attagtcatt gcagagttga aggaaggtgg catggatttt
     4981 tacgtaccca gacaagagcc aatgttcaga tggatgagat tctcagatct gagcacgtgg
     5041 gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga gtgacgccaa
     5101 cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg ttatggctct
     5161 ggagcccgtt gtcggtgccg ctattgcggc acctgtagcg ggccaacaaa atgtaattga
     5221 cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag tatcccctag
     5281 aaacgctcca ggtgaaatac tatggagcgc gcccttgggc cctgatctaa atccctacct
     5341 atctcatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc aggtaattct
     5401 cgcggggaac gcgttcaccg ccgggaaggt catatttgca gcagtcccac caaattttcc
     5461 aactgaaggc ttgagcccca gccaggtcac tatgttcccc catatagtag tagatgttag
     5521 gcaactagaa cctgtgttga ttcccttacc cgatgttagg aataatttct atcattacaa
     5581 tcaatcaaat gaccccacca ttaagttgat agcaatgttg tatacaccac ttagggctaa
     5641 taatgctggg gatgatgtct tcacagtttc ttgccgagtt ctcacgagac catcccccga
     5701 ttttgacttc atatttctag tgccacccac agttgagtca agaactaaac cattctctgt
     5761 cccagtttta actgttgagg agatgaccaa ttcaagattc cccattcctt tggaaaagtt
     5821 gttcacgggt cccagcagtg cctttgttgt ccaaccacaa aacggtaggt gcacgactga
     5881 tggcgtgctc ctaggcacca cccaactgtc tcctgtcaac atctgcacct tcagaggaga
     5941 tgtcacccat accacaggta gtcataacta cacaatgaat ttggcttctc aaaattggag
     6001 caattacgac ccaacagaag aaatcccagc ccctctagga actccagact ttgtggggaa
     6061 gattcaaggc gtgcttaccc aaaccacaag gacagatggc tcaacacgcg gccacaaagc
     6121 cacagtttat actgggagcg ccgactttgc tccaaaactg ggtagagttc aatttgaaac
     6181 tgacacaaac catgattttg aagctaacca aaacacaaag ttcaccccag ttggtgtcat
     6241 ccaagatggt ggcaccaccc accgaaatga accccaacag tgggtgctcc caagttactc
     6301 aggcagaaat actcctaatg tgcatctggc ccccgctgta gcccccactt ttccgggtga
     6361 gcaacttctc ttcttcagat ccaccatgcc cggatgcagc gggtacccca acatggattt
     6421 ggactgtctg ctcccccagg aatgggtgca gtacttctac caagaggcag ccccagcaca
     6481 atctgatgtg gctctgctaa ggtttgtgaa tccagacaca ggtagggttt tgtttgaatg
     6541 taagcttcat aaatcaggtt atgtcacagt ggctcacact ggccaacatg atttggttat
     6601 cccccccaat ggttatttta ggtttgattc ctgggtcaac cagttttaca cgcttgcccc
     6661 catgggaaat ggaacggggc gtagacgtgc actataatgg ctggagcttt ctttgctgga
     6721 ttggcatctg atgtccttgg ctctggactt ggttccctta tcaatgctgg ggctggggcc
     6781 atcaaccaaa aagttgagtt tgaaaacaac agaaaattgc aacaagcatc cttccaattt
     6841 agcagcaatc tacaacaggc ttcctttcaa catgacaaag agatgctcca agcacaaatt
     6901 gaggccacca aaaggttaca acaggaaatg atgaaagtta agcaggcaat gctcctagag
     6961 ggtgggttct ctgagacaga tgcagcccgc ggggcaatca acgcccccat gacaaaagct
     7021 ttggactgga acgggacaag gtactgggct cctgatgcta ggactacaac atacaatgca
     7081 ggccgctttt ccacccctca accatcgggg gcgctgccag gaagagctaa tcttagggat
     7141 gctgtccctg ctcggggttc ctctagtaag tcttctaatt cttctactgc tacttctgtg
     7201 tactcaaatc aaactatttc aacgagactt ggttctacag ctggttctgg taccagtgtc
     7261 tcgagcttcc cgtcaactgc aaggactagg agctgggttg aggatcaaag taggaatttg
     7321 tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc tagcagatcc
     7381 tctagccaag gcacagtctc aaccgtgcct agagagattt tggactcctg gactggcgct
     7441 ttcaacacgc gcaggcagcc actcttcgct cacattcgta agcgagggga gtcacgggtg
     7501 taatgtgaaa agacaaaatt gattatcttt cttttcttta gtgtc
//