Typing tool

Complete norovirus genomes

L07418  GI.2
 GI.P2

Length: 7,708 | 3 CDS

ORF1: 5..5371
ORF2: 5355..6995
ORF3: 6995..7630
LOCUS       SOUCAPPRO               7708 bp ss-RNA     linear   VRL 27-MAR-1996
DEFINITION  Southampton virus capsid protein, polyprotein, and ORF genes,
            complete cds.
ACCESSION   L07418
VERSION     L07418.1
KEYWORDS    Calicivirus; Norwalk-like; Southampton virus.
SOURCE      Southampton virus
  ORGANISM  Southampton virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 13 to 7708)
  AUTHORS   Lambden,P.R., Caul,E.O., Ashley,C.R. and Clarke,I.N.
  TITLE     Sequence and genome organization of a human small round-structured
            (Norwalk-like) virus
  JOURNAL   Science 259 (5094), 516-519 (1993)
   PUBMED   8380940
REFERENCE   2  (bases 1 to 7708)
  AUTHORS   Lambden,P.R., Liu,B. and Clarke,I.N.
  TITLE     A conserved sequence motif at the 5' terminus of the Southampton
            virus genome is characteristic of the Caliciviridae
  JOURNAL   Virus Genes 10 (2), 149-152 (1995)
   PUBMED   8560774
REFERENCE   3  (bases 13 to 7708)
  AUTHORS   Lambden,P.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JAN-1993) Paul R. Lambden, Molecular Microbiology,
            University of Southampton, University Medical School, Southampton
            General Hospital, Southampton S016 6YD, UK
REFERENCE   4  (bases 1 to 7708)
  AUTHORS   Lambden,P.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-MAR-1995) Paul R. Lambden, Molecular Microbiology,
            University of Southampton, University Medical School, Southampton
            General Hospital, Southampton S016 6YD, UK
COMMENT     On Mar 27, 1996 this sequence version replaced gi:712844.
            Original source text: Southampton virus cDNA to genomic RNA.
FEATURES             Location/Qualifiers
     source          1..7708
                     /organism="Southampton virus"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:11984"
     5'UTR           1..4
     CDS             5..5371
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AAA92983.1"
                     /translation="MMMASKDVVATNVASNNNANNTSATSRFLSRFKGLGGGASPPSP
                     IKIKSTEMALGLIGRTTPEPTGTAGPPPKQQRDRPPRTQEEVQYGMGWSDRPIDQNVK
                     SWEELDTTVKEEILDNHKEWFDAGGLGPCTMPPTYERVKDDSPPGEQVKWSARDGVNI
                     GVERLTTVSGPEWNLCPLPPIDLRNMEPASEPTIGDMIEFYEGHIYHYSIYIGQGKTV
                     GVHSPQAAFSVARVTIQPIAAWWRVCYIPQPKHRLSYDQLKELENEPWPYAAITNNCF
                     EFCCQVMNLEDTWLQRRLVTSGRFHHPTQSWSQQTPEFQQDSKLELVRDAILAAVNGL
                     VSQPFKNFLGKLKPLNVLNILSNCDWTFMGVVEMVILLLELFGVFWNPPDVSNFIASL
                     LPDFHLQGPEDLARDLVPVILGGIGLAIGFTRDKVTKVMKSAVDGLRAATQLGQYGLE
                     IFSLLKKYFFGGDQTERTLKGIEAAVIDMEVLSSTSVTQLVRDKQAAKAYMNILDNEE
                     EKARKLSAKNADPHVISSTNALISRISMARSALAKAQAEMTSRMRPVVIMMCGPPGIG
                     KTKAAEHLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMTKILDDCNK
                     LQAIADSAPLTLNCDRIENKGMQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVY
                     CSAPEVEQIRRVSPGDTSALKDCFKLDFSHLKMELAPQGGFDNQGNTPFGKGTMKPTT
                     INRLLIQAVALTMERQDEFQLQGKMYDFDDDRVSAFTTMARDNGLGILSMAGLGKKLR
                     GVTTMEGLKNALKGYKISACTIKWQAKVYSLESDGNSVNIKEERNILTQQQQSVCTAS
                     VALTRLRAARAVAYASCIQSAITSILQIAGSALVVNRAVKRMFGTRTATLSLEGPPRE
                     HKCRVHMAKAAGKGPIGHDDVVEKYGLCETEEDEEVAHTEIPSATMEGKNKGKNKKGR
                     GRRNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDG
                     GIGETEMEIRHRVFYKSKSRKHHQEERRQLGLVTGSDIRKRKPIDWTPPKSAWADDER
                     EVDYNEKISFEAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSI
                     AIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIA
                     SMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKS
                     GNTVVCAVQASEGETTLEGGDKGHYAGHEIIKHGCGPALSTKTKFWKSSPEPLPPGVY
                     EPAYLGGRDPRVTVGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSSLEQVMD
                     TPVPWSYSDACQSLDKTTSSGFPYHRRKNDDWNGTTFVRELGEQAAHANNMYEQAKSM
                     KPMYTGALKDELVKPEKVYQKVKKRLLWGADLGTVVRAARAFGPFCDAIKSHTIKLPI
                     KVGMNSIEDGPLIYAEHSKYKYHFDADYTAWDSTQNRQIMTESFSIMCRLTASPELAS
                     VVAQDLLAPSEMDVGDYVIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDV
                     IQSMSYFSFYGDDEIVSTDIEFDPAKLTQVLREYGLRPTRPDKSEGPIIVRKSVDGLV
                     FLRRTISRDAAGFQGRLDRASIERQIYWTRGPNHSDPFETLVPHQQRKVQLISLLGEA
                     SLHGEKFYRKISSKVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVN
                     DDGV"
     CDS             5355..6995
                     /function="viral capsid"
                     /note="putative"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="AAA92984.1"
                     /translation="MMMASKDAPQSADGASGAGQLVPEVNTADPLPMEPVAGPTTAVA
                     TAGQVNMIDPWIVNNFVQSPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLSQMYNG
                     WVGNMRVRILLAGNAFSAGKIIVCCVPPGFTSSSLTIAQATLFPHVIADVRTLEPIEM
                     PLEDVRNVLYHTNDNQPTMRLVCMLYTPLRTGGGSGNSDSFVVAGRVLTAPSSDFSFL
                     FLVPPTIEQKTRAFTVPNIPLQTLSNSRFPSLIQGMILSPDASQVVQFQNGRCLIDGQ
                     LLGTTPATSGQLFRVRGKINQGARTLNLTEVDGKPFMAFDSPAPVGFPDFGKCDWHMR
                     ISKTPNNTGSGDPMRSVSVQTNVQGFVPHLGSIQFDEVFNHPTGDYIGTIEWISQPST
                     PPGTDINLWEIPDYGSSLSQAANLAPPVFPPGFGEALVYFVSAFPGPNNRSAPNDVPC
                     LLPQEYITHFVSEQAPTMGDAALLHYVDPDTNRNLGEFKLYPGGYLTCVPNGVGAGPQ
                     QLPLNGVFLFVSWVSRFYQLKPVGTASTARGRLGVRRI"
     CDS             6995..7630
                     /note="ORF; putative"
                     /codon_start=1
                     /protein_id="AAA92985.1"
                     /translation="MAQAIIGAIAASAAGSALGAGIQAGAEAALQSQRYQQDLALQRN
                     TFEHDKDMLSYQVQASNALLAKNLNTRYSMLIAGGLSSADASRAVAGAPVTRLIDWNG
                     TRVAAPRSSATTLRSGGFMAVPMPVQPKSKTPQSSGFSNPAYDMSTVSSRTSSWVQSQ
                     NSLRSVSPFHRQALQTVWVTPPGSTSSSSVSSTPYGVFNTDRMPLFANLRR"
     3'UTR           7631..7708
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcaactaat gttgcaagca ataacaatgc
       61 taacaacact agtgctacat ctcgattttt atcgagattt aagggcctag gaggtggcgc
      121 aagcccccct agccctataa aaattaaaag tacagaaatg gctctggggt taattggcag
      181 aacgacccca gaaccaacag ggaccgctgg tccaccaccc aaacaacaga gggaccgacc
      241 tcctagaact caggaggagg tccagtatgg tatggggtgg tctgacaggc ccattgatca
      301 aaacgtcaaa tcatgggaag agcttgacac cacagtcaag gaagagatcc tagacaacca
      361 caaggaatgg tttgacgctg gtggtttggg tccttgcaca atgcctccaa catatgaacg
      421 ggtcaaggat gacagtccac ctggtgaaca ggttaaatgg tccgcacgtg atggagtcaa
      481 cattggagtg gagcgcctca caacagtgag tggacccgag tggaatcttt gccctttacc
      541 ccccattgac ttgaggaata tggaaccagc tagtgaaccc actattggag atatgataga
      601 attctatgaa ggccacatct atcattactc catatacatt gggcaaggca aaacagtcgg
      661 cgtccattct ccacaggcag cgttctcagt ggctagggtg accatccaac ccatagccgc
      721 ttggtggagg gtttgttaca taccccaacc caagcacaga ctgagttacg accaactcaa
      781 ggaattagag aatgagccat ggccatatgc ggccataacc aataattgtt ttgaattctg
      841 ctgtcaagtc atgaatcttg aggacacatg gttacaaagg cggctggtca cgtcgggcag
      901 attccaccac cccacccaat cgtggtcaca acagacccct gagttccagc aagatagcaa
      961 gttagagttg gtcagggacg ccatattagc tgcagtaaat ggtcttgttt cgcagccctt
     1021 taagaacttc ttgggtaaac tcaaacctct caatgtgctc aacattctgt ccaactgtga
     1081 ttggaccttc atgggagtgg tggagatggt catactatta cttgaactct ttggcgtgtt
     1141 ctggaacccg cctgatgtgt ccaatttcat agcgtccctc ctccctgact tccatcttca
     1201 gggacctgaa gacttggcac gagatctagt cccagtgatt cttggcggta taggactggc
     1261 catcgggttc accagagata aggtcacaaa ggttatgaag agtgctgtgg atggtcttcg
     1321 agctgctaca caattgggac agtatgggtt agaaatattc tcactactca aaaagtattt
     1381 ctttgggggg gatcagactg agcgcaccct caaaggcatt gaggcggcag tcatagatat
     1441 ggaagtgttg tcctccacat cagtgacaca gctagtgagg gacaaacagg cagcaaaagc
     1501 ttatatgaac atcttggaca atgaagaaga gaaggccagg aagctctctg ctaaaaacgc
     1561 tgacccacat gtgatatcct caacaaatgc cctaatatcg cgcatatcca tggcacgatc
     1621 tgcattggct aaggcccagg ctgaaatgac cagtcgaatg agaccagttg tcattatgat
     1681 gtgtggtcca cctgggattg ggaagaccaa ggctgctgag cacctagcaa aacgtctagc
     1741 caatgagatc agacctggtg gtaaggtggg gttagttccc cgtgaagctg tcgaccactg
     1801 ggacggttat catggtgagg aagtgatgct gtgggacgac tatggcatga caaaaatact
     1861 cgatgactgt aataaactcc aagccattgc tgattcggcc ccacttacct taaattgtga
     1921 taggattgaa aacaaaggaa tgcagttcgt ttcagatgca atagtcatca ccaccaacgc
     1981 cccaggcccc gcccctgtgg actttgtcaa ccttggtcca gtgtgtagac gggtcgactt
     2041 cttggtctac tgctctgccc cagaggtgga acagatacgg agggttagcc ctggtgatac
     2101 atcagcactg aaagactgct tcaagctaga cttctcccat ttaaaaatgg aactggcccc
     2161 acaaggtggg tttgacaatc aagggaacac accgtttggc aaaggtacca tgaagccaac
     2221 aaccattaac agacttctca tacaagctgt ggcccttacc atggaaaggc aggatgagtt
     2281 ccagctacag ggaaagatgt atgactttga tgatgacagg gtgtcagcgt tcaccaccat
     2341 ggcacgtgat aatggcctag gcatcctgag catggcaggt ctgggtaaga agctacgcgg
     2401 tgtcacaacg atggagggct taaaaaatgc cctgaagggg tacaaaatta gtgcgtgcac
     2461 gataaaatgg caggccaaag tgtactcact agaatcagat ggtaacagtg tcaacattaa
     2521 agaggagagg aacatcctaa ctcagcaaca acagtcggtg tgtactgcct ctgtcgcgct
     2581 cactcgtctt cgagctgcgc gcgcggtggc atacgcgtca tgcatccagt cggctataac
     2641 ttccatacta caaattgctg gctcagccct agtggtcaac agagcagtga agagaatgtt
     2701 tggcacgcgt actgccacct tgtccctaga gggccccccc agagaacaca aatgcagggt
     2761 ccatatggcc aaggccgcag gaaagggacc tattggccat gatgatgtgg tagaaaagta
     2821 tgggctttgc gaaactgagg aggacgaaga agtggcccac actgaaatcc cttctgctac
     2881 catggaaggc aagaacaagg ggaagaacaa gaaaggacgt ggtcggagga acaattacaa
     2941 cgccttctcc cgcagaggac tcaatgatga agagtacgaa gagtacaaga agatacgcga
     3001 ggagaaaggt ggcaattata gcatacagga gtacctagaa gacagacaaa gatatgaaga
     3061 agagctagca gaggttcaag caggcggaga tggaggaatt ggggaaactg aaatggaaat
     3121 ccgccacaga gtgttctaca aatccaagag cagaaagcat caccaggaag agcgacgcca
     3181 gctagggctg gtgacaggct ccgacattcg gaagagaaaa ccaatcgact ggaccccacc
     3241 caagtcagca tgggcagatg atgagcgtga ggtagattac aatgagaaga tcagctttga
     3301 agcgcccccc actttatgga gcagagtgac aaagtttggg tctggatggg gtttctgggt
     3361 cagccctaca gtcttcataa ccacaacgca cgttatacca accagtgcga aggagttctt
     3421 tggtgaaccc ctaaccagca tagccatcca cagggctggt gagtttactc tcttcaggtt
     3481 ttcaaagaaa attaggcctg atcttacagg tatgatcctt gaggagggtt gccccgaggg
     3541 cacggtgtgt tcagtactaa taaagaggga ctctggtgaa ctactgccat tggccgtgag
     3601 aatgggcgcg atagcatcaa tgcgcataca gggccgcctt gtccatgggc aatctggcat
     3661 gttactcact ggtgctaatg ctaagggcat ggatcttgga accatcccag gagactgtgg
     3721 ggctccttat gtttataaga gagctaatga ctgggtggtc tgtggtgtgc acgctgctgc
     3781 caccaaatca ggcaacaccg ttgtgtgcgc cgttcaggcc agtgaaggag aaaccacgct
     3841 tgaaggcggt gacaaaggtc attatgctgg acatgaaata attaagcatg gttgtggacc
     3901 agccctatca actaagacca aattctggaa atcatccccc gaaccactgc cccctggggt
     3961 ttatgaaccc gcctacctcg ggggccggga ccctagggtg actgtcggtc cctcacttca
     4021 acaagtgttg cgggatcagc taaagccatt tgctgagcca cgaggacgca tgccagagcc
     4081 aggtctcttg gaggccgcag ttgagactgt gacttcatca ttagagcagg ttatggatac
     4141 tcccgtcccc tggagctata gtgatgcgtg ccagtccctt gacaagacca ctagttctgg
     4201 cttcccctac cacagaagga agaatgacga ctggaatggc accacctttg ttagggagtt
     4261 aggtgagcag gcggcacacg ccaacaacat gtatgagcag gctaaaagta tgaaacccat
     4321 gtacacggga gcacttaaag atgaactagt caaaccagag aaagtatacc agaaagtgaa
     4381 aaagcgcttg ttatgggggg cagacttggg cacggtagtt cgggctgcac gggcttttgg
     4441 cccattctgt gatgctataa aatcccacac aatcaagttg cctatcaaag ttggaatgaa
     4501 ttcaattgag gatgggccac tgatctatgc agaacattca aaatataagt accactttga
     4561 tgcagattac acagcttggg actcaactca aaataggcaa atcatgacag agtcattttc
     4621 aatcatgtgt cggctaactg catcacccga actagcttcg gtggtggctc aagacttgct
     4681 cgcaccctca gagatggatg ttggcgacta cgtcataaga gtgaaggaag gcctcccatc
     4741 tggtttccca tgcacatcac aagttaatag tataaaccat tggttaataa ctctgtgcgc
     4801 cctttctgaa gtgactggcc tgtcgccaga cgttatccaa tccatgtcat atttctcttt
     4861 ctatggtgat gatgaaatag tgtcaactga catagaattt gatccagcaa aactgacaca
     4921 agttcttagg gagtatggac ttagacccac ccgccccgac aaaagcgagg gcccaataat
     4981 tgtaaggaag agtgtggatg gtttggtctt cttacgtcgc actatctccc gtgacgctgc
     5041 gggatttcaa gggcgactgg accgagcatc cattgaaaga caaatctact ggactagagg
     5101 acccaaccat tcagaccctt ttgaaaccct ggtgccacac caacaaagga aagtccaact
     5161 aatatcatta ttgggtgagg cctcactgca tggtgagaag ttctacagga agatttcaag
     5221 caaagtcatc caggaaatta aaacaggggg ccttgaaatg tacgtgccag gatggcaagc
     5281 catgttccgt tggatgcggt tccatgacct tggtttgtgg acaggagatc gcaatctcct
     5341 gcccgaattt gtaaatgatg atggcgtcta aggacgcccc tcaaagcgct gatggcgcaa
     5401 gcggcgcagg tcaactggtg ccggaggtta atacagctga ccccttaccc atggaacccg
     5461 tggccgggcc aacaacagcc gtagccactg ctgggcaagt taatatgatt gatccctgga
     5521 ttgttaataa ttttgtccag tcaccacaag gtgagttcac aatttcccct aataataccc
     5581 ccggtgatat tttgtttgat ttacaattag gtccacatct aaaccctttc ttgtcacatt
     5641 tgtcccaaat gtataatggc tgggttggaa atatgagagt taggattctt cttgctggga
     5701 atgctttctc agctggaaag attatagttt gttgtgtccc ccctggcttc acgtcttcct
     5761 ctctcaccat agctcaggct acattgtttc cccatgtgat tgctgatgtg agaacccttg
     5821 aaccaataga aatgcctctc gaggatgtac gcaatgtcct ctatcacacc aatgataatc
     5881 aaccaacaat gcggttggtg tgtatgctct acacgccgct ccgtactggt gggggatctg
     5941 gtaattctga ttctttcgta gttgctggta gggtgctcac ggctcctagt agcgacttca
     6001 gtttcttgtt ccttgtccca cctactatag aacagaagac tcgggctttt actgtgccta
     6061 atatcccctt gcaaaccttg tccaattcta gatttccttc cctcatccag gggatgatcc
     6121 tgtctcctga cgcatctcaa gtggtccagt ttcaaaatgg acgatgcctt atagatggcc
     6181 aactcctagg caccacaccc gctacatcag gacagctgtt cagagtaaga ggaaagataa
     6241 atcagggagc ccgcacgctt aacctcacag aggtggatgg caaaccattc atggcatttg
     6301 attcccctgc acctgtgggg ttccccgatt ttggaaaatg tgattggcat atgagaatca
     6361 gcaaaacccc aaataacaca ggctcaggtg atcccatgcg cagtgtcagc gtgcagacca
     6421 acgtgcaggg ttttgtacca cacctgggaa gcatacagtt tgatgaagtg ttcaaccacc
     6481 ccacaggtga ctacattggc accattgaat ggatttccca gccatctaca cctcctggaa
     6541 cagatattaa tctgtgggag attcccgatt atggatcatc cctttcccaa gcagctaatc
     6601 tggccccccc agtattcccc cctggatttg gtgaggctct tgtgtacttt gtttctgctt
     6661 ttccaggccc caacaaccgc tcagccccga atgatgtacc ttgtcttctt cctcaagagt
     6721 acataaccca cttcgtcagt gaacaagccc caacaatggg tgacgcagct ttgctgcatt
     6781 atgtcgaccc tgataccaac aggaaccttg gggagttcaa actataccct ggaggttacc
     6841 tcacctgtgt accaaacggg gtgggtgccg ggcctcaaca gcttcctctt aatggtgttt
     6901 ttctctttgt ctcttgggta tctcgctttt atcagctcaa gcctgtggga acagccagta
     6961 cggcaagagg taggcttgga gtgcgccgta tataatggcc caagccatta taggagcaat
     7021 tgccgcgtca gctgctggct cagcattggg tgcgggcatc caggctggtg ccgaagctgc
     7081 gcttcagagt cagagatacc aacaagactt agccctgcaa aggaatactt ttgaacatga
     7141 taaagatatg ctttcctacc aggttcaggc aagtaatgca cttttagcaa agaatctcaa
     7201 tacccgctat tctatgctta ttgcaggagg tctttctagt gctgatgctt cacgggctgt
     7261 tgctggagcc ccagtaacac gattgattga ttggaacggc actcgggttg ccgcccccag
     7321 atcaagtgca acaactctga ggtctggtgg cttcatggca gttcccatgc ctgttcaacc
     7381 caaatctaag accccacaat cctctgggtt ctctaatcct gcttatgata tgtccacagt
     7441 ttcctctagg acttcttctt gggtgcagtc acaaaattcc ctgcgaagtg tatcaccatt
     7501 ccacaggcag gccctgcaga ctgtatgggt cactccacct gggtctactt cttcttcttc
     7561 tgtttcctca acaccttatg gtgtttttaa cacggatagg atgccgctat tcgcaaattt
     7621 gcggcgctaa tgttgtaata taatgcagca gtgggcacta tattcaattt ggtttaatta
     7681 gtaaataatt tggctattga ttagtgtt
//