Typing tool

Complete norovirus genomes

KY934262  GI.3
 GI.P3

Length: 7,778 | 3 CDS

ORF1: 5..5404
ORF2: 5388..7025
ORF3: 7025..7672
LOCUS       KY934262                7778 bp    RNA     linear   VRL 23-APR-2017
DEFINITION  Norovirus GI isolate 0304-19, complete genome.
ACCESSION   KY934262
VERSION     KY934262.1
KEYWORDS    .
SOURCE      Norovirus GI
  ORGANISM  Norovirus GI
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7778)
  AUTHORS   Zheng,L., Chen,X. and Huo,Y.
  TITLE     Expression and characterization of major capsid protein derived
            from a GI.3 norovirus strain isolated in China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7778)
  AUTHORS   Zheng,L., Chen,X. and Huo,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-APR-2017) Center for Translational Medicine, The
            Sixth People's Hospital of Zhengzhou, Jingguangnan Road No. 29,
            Zhengzhou, Henan 450000, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7778
                     /organism="Norovirus GI"
                     /mol_type="genomic RNA"
                     /isolate="0304-19"
                     /isolation_source="feces"
                     /db_xref="taxon:122928"
                     /country="China"
                     /collection_date="04-Mar-2015"
                     /note="genotype: GI.3"
     CDS             5..5404
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ARI71146.1"
                     /translation="MMMASNDAIAVADVSNNNANTNNDNIGSRLMARIRGRIGPQRGE
                     TTTKIKDANMALDLLRRSQTPSPSRQESPPKSQRDRPPRTASEVKKVLGWDVEPEHQE
                     STAKAWCDLTQEEKEEIMRNNEKLFDAGGITPSTLPSTFERADPVDSPIEQQPVTWSA
                     SGGVDIGVNDLTTVRGPFWNMCPLPPLDARNNGPAKEPLIGDMIEFYEGHIFHYAIYI
                     GQGKTIGVHSPQAAFSIPRITIHPLVAWWRVCYVPTNQQRLTYDQLKELENEPWPYAS
                     ITNNCYEFCCRVMALDDTWLERRLVSTGKFNHPTQDWSQDTPDFHQDSKLEMVRDAVL
                     SAINGLVSQPFKNILSKIKPLNVLNLLSNCDWTFMGVVELIVLLAELFDVFWTPPDIS
                     SFIASLLPEFHLQGPEDLARDLVPLILGGIGLAIGFTRDKVTKVMKSAVDGLRSATQL
                     GQYGLEIFSIIKKYFFGGDQTEKTLRGIEDAVIDMEVLSSTNVTQLVKDKKLARTYMN
                     VLDNEEEKARKLSVRSADPHIVTSVNNLISRISMARSALAKAQAEMTSRPRPVVIMMC
                     GPPGIGKTKAAEHLAGRLANEIRPGGKVGLVPRESIDHWDGYHGEDVLLWDDYGMSKI
                     TEDCNKLQAIADTAPLSLNCDRIENKGMQFSSDAIIITTNAPGPAPVDFVNLGPVCRR
                     VDFLVYCSAPEIEQMRRTHPGDANAIKDLYKRDYSHLKMELAPQGGFDSQGNTPFGKG
                     IMKPTTLNRLLIQATALAMERQDEFQLQGAVYNFDEDRVSAFTSLARANGLGLLSMAT
                     LGKRLRSVKSMEGLRNALVGYKIGECDIIWNTRVYSIKSDGSTVTIKEKQTPTSPQYQ
                     AISTATLALSRLRAARALAYASCLQSAVLSILQVAGSALVVSRAVKRMFGTRTEQPML
                     EGKHKEHNCRVHRAEAAGHGPIGHDGVIERYGLCESEQEEEGEQTVELPTANKEGKNK
                     GKTKKGRGRKSNFNAFSRRGVSDEEYEEYKKIREEKSGNYSIQEYLEDRQRYEEELAE
                     VQAGGDGGIGETEAEIRHRVFYKSKSGMRKQRQEERRQLGLVSGSEIRKRKPIDWTPP
                     KNDWSEDTRTVNYDEHISFEAPPSIWSRVVKFGSGWGFWVSSTVFITTTHVIPPGVKE
                     VFGEDLSNVAIHRVGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCTIMIKRDSGELLP
                     LAVRMGAVASMKIQGKLMHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVC
                     GVHAAATKSGNTVVCAIQGGDGEATLEGGGQNKGHYAGHPILRYGNGPSLSTKTKFWK
                     STPQPLPPGTYEPAYLGGRDPRVEGGPSLQQVLRDQLKPFAEPRGRLPEAGLLEAAVE
                     TVTNAIEQVMDTPVAWSYSDACMSLDKTTSSGHPHHKKKNDDWNGSSFVRELGDQAAH
                     ANSMYELGKSMKPVYTAALKDELVKPDKVYTKIKKRLLWGADLGTVIRAARAFGPFCE
                     AIKPHVIKLPIKVGMNAIEDGPLIYAEHSKYKFHYDADYTAWDSTQNREIMMESFNIM
                     CKLTANPSLAAVVAQDLLSPSEMDVGDYVISVKDGLPSGFPCTSQVNSINHWILTLCA
                     LSEVTGLSPDVIQSQSYFSFYGDDEIVSTDIEFDPIRLTQILKEYGLKPTRPDKTDGP
                     IIVRQQVDGLVFLRRTISKDAIGYQGRLDRNSIERQLWWTRGPNHEDPFETLVPHSQR
                     KVQLISLLGEAALHGEKFYRKIAGRVIQEVKEGGLEIYIPGWQAMFRWMRLHDLSLWT
                     GDRDLLPDYVNDDGV"
     CDS             5388..7025
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ARI71147.1"
                     /translation="MMMASKDAPTNMDGTSGAGQLVPEANTAEPISMEPVAGAATAAA
                     TAGQVNMIDPWIMNNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLAQMYNG
                     WVGNMKVKVLLAGNAFTAGKIIISCIPPGFAAQNISIAQATMFPHVIADVRVLEPIEV
                     PLEDVRNVLFHNNDNTPTMRLVCMLYTPLRASGSSSGTDPFVIAGRVLTCPSPDFSFL
                     FLVPPNVEQKTKPFSVPNLPLNTLSNSRVPSLIKSMMVSRDHGQMVQFQNGRVTLDGQ
                     LQGTTPTSASQLCKIRGSVFHANGGNGYNLTELDGSPYHAFESPAPIGFPDLGECDWH
                     MEASPTTQFNTGDVIKQINVKQESAFAPHLGTIQADGLSDVSVNTNMIAKLGWVSPVS
                     DGHKRDVDPWVIPRYGSTLTEAAQLAPPIYPPGFGEAIVFFMSDFPIAHGTNGLSVPC
                     TIPQEFVTHFVNEQAPTRGEAALLHYLDPDTHRNLGEFKLYPDGFMTCVPNSSGTGPQ
                     TLPINGVFVFVSWVSRFYQLKPVGTAGPARRLGIRRS"
     CDS             7025..7672
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="ARI71148.1"
                     /translation="MAQAILGAIAATAAGSAVGAGIQAGTEAALQHQRFQQDLTLQKN
                     SFIHDKEMMGLQVEASTALLQNSLGTRYNMLTKAGMTSADAARMVVGAPATRVIDWNG
                     TRIAAPMSTATTLRSGGFMTVPTVYRGGKNKQSIGGGFSNVNYDPSVSSSRTSQWVSS
                     QNSMRSTLEPFHPGALRTTWVTPPGSTSTSTISTVSTVPKFFNTERLPLFANRGK"
ORIGIN      
        1 gtgaatgatg atggcgtcta acgacgctat tgccgttgct gatgtcagca ataacaatgc
       61 taacaccaac aatgataaca tcggatcccg cctcatggcg aggatccgtg ggcgtatagg
      121 cccacaacgt ggtgaaacaa ccacaaaaat aaaagacgcc aatatggcgc ttgatctgct
      181 acgccggtca caaacacctt ccccatcccg acaagagagc cctcctaaga gccagagaga
      241 ccgccccccc cggactgctt ctgaagtgaa gaaagtgttg gggtgggatg ttgaaccaga
      301 acaccaggaa agcacggcca aggcatggtg cgacctcacg caagaagaga aggaggagat
      361 aatgcgcaac aatgaaaagc tcttcgatgc tgggggaatc accccatcaa ctttgcctag
      421 cacgtttgaa agggctgacc cagttgatag ccccattgaa cagcaacctg taacatggtc
      481 tgctagcggt ggggtcgata ttggtgtcaa tgatttaacc accgtccgtg gtccattttg
      541 gaatatgtgc cccctcccgc cactggatgc tcggaataat ggccccgcta aggagcccct
      601 cataggagat atgatagagt tctatgaggg tcatattttt cattatgcca tctatattgg
      661 acaaggtaag accattgggg tccactcacc gcaagcagct ttctccatac caaggataac
      721 catccatcct ctagtggcct ggtggcgcgt gtgctacgtt ccaactaatc agcagcgcct
      781 cacttatgac cagctcaaag agttggagaa tgagccatgg ccctacgctt ccattacaaa
      841 caattgctat gaattttgct gcagagtgat ggcacttgac gacacatggc ttgagaggag
      901 gttagtcagc actgggaaat tcaaccaccc cacacaagat tggtcacagg ataccccgga
      961 ttttcaccaa gactcgaaac ttgagatggt aagagatgcc gtgctatcag ccattaatgg
     1021 ccttgtgtca caacccttta aaaacatttt gtcaaagatc aaaccattaa atgttctcaa
     1081 cctcttgtca aattgtgatt ggaccttcat gggggttgtg gaactgattg tgctcctagc
     1141 ggagttgttt gatgtgttct ggaccccacc agatatctca agtttcattg cctcactact
     1201 acctgaattt cacctgcagg gccctgaaga cctagctagg gacttggtcc ctctcatcct
     1261 aggtggcata ggcttggcta ttggctttac aagagacaaa gtgacgaaag tgatgaagag
     1321 cgccgtcgat gggctgagat cggcgacaca actcgggcag tacgggctgg aaatattctc
     1381 aatcatcaag aaatatttct ttggtgggga ccaaacggaa aagaccttgc ggggtattga
     1441 ggatgcggtg atagatatgg aggtattgtc tagcaccaat gtgacacaat tggttaaaga
     1501 taagaaattg gccagaacct atatgaatgt gctagacaat gaagaggaaa aagcaaggaa
     1561 actctcagtc cgtagtgctg atccgcacat agtgacctca gtcaacaatc tgatatcacg
     1621 gatatctatg gcaagatcag ccttggccaa agcccaggct gagatgacat ctcgcccacg
     1681 ccctgtagtc ataatgatgt gtggcccccc cggcatcgga aaaaccaagg ccgccgaaca
     1741 cctggctggc cgattggcaa acgagattag accgggaggt aaggttggac ttgtgccccg
     1801 ggaatccata gatcactggg acggatacca tggcgaggat gtcctactat gggatgacta
     1861 tggcatgtca aagataacag aggactgtaa taagctacaa gccatagctg acactgcacc
     1921 cctatcactc aattgtgaca ggatagagaa caaaggcatg caattctcct cagatgcaat
     1981 aatcataacc accaatgccc ctggcccggc cccggtggac tttgtcaacc tgggccctgt
     2041 gtgcaggcga gtggactttt tagtttactg ctctgctcct gaaattgagc aaatgagaag
     2101 gacccatcct ggtgatgcca atgccatcaa agacctatat aaaagggact actcacactt
     2161 aaaaatggaa ttggccccac aaggtggttt tgatagtcag ggtaacacac catttgggaa
     2221 gggtatcatg aagcccacga ccctcaatag gctactcatt caggcaacag cattagctat
     2281 ggagcggcaa gatgagttcc agcttcaagg ggctgtctac aactttgatg aagacagggt
     2341 gtccgccttc acaagcctgg cccgagctaa cggcttgggg cttttaagca tggcaacatt
     2401 gggtaaaagg ctcagaagtg tcaaatctat ggagggcctg cgtaacgctt tggtgggcta
     2461 caaaatagga gagtgtgata taatctggaa cactagagtg tattcaatta aaagtgatgg
     2521 tagtactgtc acaatcaagg aaaaacaaac tccaacttca cctcaatacc aggccattag
     2581 cacagctact cttgcactct ctaggttgcg ggccgctaga gccctcgcgt acgcctcctg
     2641 cctgcagagt gcagtgctgt caatacttca agtagctggc tctgccctag tggtgagcag
     2701 agccgttaaa cgcatgtttg gcacgcgcac tgaacaacct atgttggaag gcaagcacaa
     2761 agaacacaac tgcagagtgc accgcgcaga ggcagctggc catggtccta ttgggcacga
     2821 tggagtcatc gaacgctatg gcctttgtga gagtgagcaa gaagaagaag gtgagcaaac
     2881 agttgagcta cccactgcca ataaagaagg caaaaacaag ggcaagacca aaaagggccg
     2941 tggacgaaag tccaatttta atgctttctc aagacgaggc gtcagtgatg aagagtatga
     3001 agaatacaag aagatcagag aagaaaagag tggcaattac agcatccagg agtacctcga
     3061 ggaccggcaa cgatatgagg aagaacttgc tgaagtgcag gctggtgggg atggtggaat
     3121 tggtgagact gaggcagaga ttcgccatcg ggttttctat aaatcaaaat ccggtatgag
     3181 aaagcaacgc caagaagaac ggcgtcagtt gggcctcgtc agcggctctg agatccgcaa
     3241 acgcaagccc atagactgga ccccccctaa gaatgattgg tcagaggaca ccaggactgt
     3301 caactatgat gaacacatca gctttgaagc ccctccctca atttggagta gggtggtgaa
     3361 gtttggcagt ggttggggtt tttgggtaag ctcaacagtg ttcataacca caacccatgt
     3421 cataccacct ggggttaaag aagtctttgg tgaagacctc agtaatgtgg ccatccatag
     3481 agttggtgag ttcacccagt tccgcttctc caaaaagatg agacctgacc tcaccggtat
     3541 ggtcttagaa gaaggttgcc cagagggaac agtgtgcacc ataatgatca agagagactc
     3601 tggtgagttg ctgccgctcg ccgttcggat gggggcagtg gcttcaatga agatccaagg
     3661 taaacttatg catgggcaat caggaatgtt actcaccggt gctaatgcca aaggcatgga
     3721 ccttgggact atacccggtg attgtggggc accctatgtc cacaagaggg gaaatgattg
     3781 ggtggtctgt ggagtacatg cagccgccac aaaatcaggc aatactgtgg tgtgcgccat
     3841 acagggtggc gatggtgaag ccactctaga aggcggcggt cagaacaagg gccactatgc
     3901 agggcatccg atattaaggt atgggaatgg cccttcgcta tcaaccaaaa caaaattttg
     3961 gaaatcaacc ccccagcctt tgcctcctgg tacatatgag ccagcttacc ttggaggcag
     4021 agaccccaga gttgaggggg gcccatcctt acaacaggtg ttaagggacc agttaaaacc
     4081 atttgccgag ccccgtggta gattacctga agcgggcttg ttggaagctg cagttgagac
     4141 ggtcaccaat gctattgaac aggttatgga cacaccggtg gcatggagct acagtgatgc
     4201 ttgcatgtcc ctagataaga caaccagttc cggccacccc catcacaaga agaaaaatga
     4261 tgattggaat gggagttcat ttgtgagaga attgggcgac caggcggcgc atgctaacag
     4321 catgtatgaa cttggtaagt ccatgaaacc tgtgtataca gcagccctaa aggatgagct
     4381 agtcaaacca gacaaggtgt acacaaaaat caaaaagaga ctgctctggg gcgcggacct
     4441 cggtaccgtc attcgcgctg ccagagcatt tggaccattt tgtgaggcca taaaacccca
     4501 tgtgattaag ttgcctatca aggtgggtat gaatgccata gaggatggcc ctttgattta
     4561 tgcagagcac tccaaatata aatttcatta tgatgctgac tatacagctt gggactcaac
     4621 acaaaacaga gaaatcatga tggagtcttt caacatcatg tgtaagctca cagccaatcc
     4681 ctccttggcc gcagtggtgg cgcaggatct actctcccca tctgaaatgg atgttggtga
     4741 ctatgtgatc agtgtcaaag atggtctgcc atctggcttt ccatgcactt cacaggtaaa
     4801 cagcatcaac cactggattc taaccctgtg tgcattgtca gaagtcactg gcttgtcccc
     4861 agatgtgata cagtcacaat cctacttctc attctatggt gatgatgaaa tagtctcaac
     4921 agacatagaa tttgacccaa ttaggttgac acaaatactg aaggaatatg gtttgaaacc
     4981 tacaagacct gacaaaactg atggcccaat tattgtcaga caacaggttg atggtctagt
     5041 cttcctccgg cgcaccatct ctaaggatgc cattggatac cagggacgac tcgaccgtaa
     5101 ctctattgaa aggcagcttt ggtggactcg cggaccaaac catgaggacc catttgagac
     5161 actggtccca cattcacaga gaaaggtcca attaatatcc ttgctgggtg aagcagcact
     5221 ccacggtgaa aagttctaca ggaagatagc tggtagggtt attcaagaag tcaaagaggg
     5281 agggcttgaa atctacattc ctggttggca ggccatgttc cgctggatgc gactccatga
     5341 tctaagtttg tggacaggag accgcgatct cctgcccgat tatgtaaatg atgatggcgt
     5401 ctaaggacgc cccaacaaac atggatggca ccagtggtgc cggccagctg gtaccagagg
     5461 caaatacagc tgagcctata tcaatggagc ccgtggctgg ggcagcaaca gctgccgcaa
     5521 ctgctggcca agttaatatg attgacccct ggataatgaa caattatgta caagcccccc
     5581 aaggtgaatt taccatatcg cctaacaaca caccaggtga cattttgttt gatttacaat
     5641 taggccccca tcttaaccct ttcttgtctc atttggccca aatgtataac ggctgggttg
     5701 gcaatatgaa agtgaaggtt ctattggctg gcaatgcttt cacggctggc aaaataatta
     5761 ttagttgcat accccctggc ttcgccgcac aaaatatttc tattgcccag gctaccatgt
     5821 tcccccatgt catagctgat gtcagggtgt tggaacccat tgaggtgcca ttggaagatg
     5881 tgaggaatgt gctctttcac aacaatgata acacgccaac tatgcggttg gtgtgcatgc
     5941 tctacacccc cttgcgggcc agtggtagct cgtctggaac tgaccccttt gtgattgccg
     6001 ggcgtgtttt gacatgcccg agtcctgatt ttagcttttt gtttttggtc ccccccaatg
     6061 tggaacaaaa gaccaagcct tttagtgtcc caaaccttcc attgaacacc ctttcaaatt
     6121 cgagagtccc ttctctaatt aaatcaatga tggtgtctag ggaccatggg cagatggttc
     6181 agtttcaaaa tggtagggtc accctagatg gacagttgca aggcaccaca cccacatcag
     6241 ctagtcagct gtgcaaaatc aggggcagtg tctttcatgc caatggtggg aatgggtata
     6301 acctaacaga actggatggg agcccatacc atgcatttga gagccccgca ccaatagggt
     6361 ttccagatct gggtgaatgt gattggcaca tggaggcttc tcctaccacc caatttaata
     6421 ctggagatgt cataaaacaa attaatgtca aacaagagtc agcatttgcc cctcaccttg
     6481 gcactataca ggcagacggc ctgagtgatg tgagtgtcaa caccaacatg atagctaaat
     6541 taggatgggt gtcacccgtc agtgatggtc acaaaaggga tgtcgacccg tgggtcatcc
     6601 cacgctatgg ttcaaccctg actgaggccg cccaattagc ccccccaata tatcccccag
     6661 gctttggtga ggccattgtg tttttcatgt cagattttcc cattgcccat ggtaccaatg
     6721 gcttaagtgt gccctgcacc ataccccaag aatttgtcac ccattttgtc aatgaacaag
     6781 cccctactag aggggaagca gccttgctac attatctgga ccctgatact catagaaatc
     6841 ttggtgagtt caaattatat cctgatggct tcatgacatg tgtgcctaac tccagtggca
     6901 ctggtccaca aactcttcca attaatggtg tctttgtttt tgtgtcctgg gtttctagat
     6961 tttatcaatt aaagcctgtg ggaacagccg gcccggctcg taggcttggg attaggagat
     7021 cataatggct caagccatac ttggagccat agcagcaaca gcagccggta gtgctgttgg
     7081 tgctggtata caagctggaa ccgaagctgc cctacagcat caaagatttc agcaagattt
     7141 gaccttacaa aagaattcct ttattcatga taaagagatg atgggtctac aggtagaggc
     7201 ttcaactgca ctcctccaaa acagtttggg tacaaggtac aatatgttaa ccaaagctgg
     7261 gatgacatcc gcagacgcgg ctcgtatggt agtgggggcg cctgctactc gtgtcattga
     7321 ctggaatgga actaggatcg ccgcgcccat gtcaactgcg acgacactta ggtctggtgg
     7381 ttttatgacc gtgccaactg tttatagggg tggtaagaat aaacaatcaa ttggtggtgg
     7441 tttttctaat gtaaattatg atccctcagt ctcctcttct cgtacttctc aatgggtctc
     7501 ttctcaaaat tcaatgcgtt ctactttgga accatttcat ccaggtgctc tgagaaccac
     7561 atgggtcact ccacctgggt caacttctac ttctacaatt tccacagtct ctactgtgcc
     7621 aaaattcttc aatacagaaa ggttaccctt attcgcaaac aggggtaagt gatttttgta
     7681 atatgaatta gtgggcatca tattcaattt ggaatcaatt agatatttag attggcagat
     7741 gatgttaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa
//