Typing tool

Complete norovirus genomes

KY348697  GII.3
 GII.P12

Length: 7,492 | 3 CDS

ORF1: 2..5098
ORF2: 5079..6725
ORF3: 6725..7489
LOCUS       KY348697                7492 bp    RNA     linear   VRL 23-JUL-2017
DEFINITION  Norovirus Hu/Guangzhou/GZ2013-L20/CHN/2013, partial genome.
ACCESSION   KY348697
VERSION     KY348697.1
KEYWORDS    .
SOURCE      Norovirus Hu/Guangzhou/GZ2013-L20/CHN/2013
  ORGANISM  Norovirus Hu/Guangzhou/GZ2013-L20/CHN/2013
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7492)
  AUTHORS   Xue,L., Wu,Q., Dong,R., Cai,W., Wu,H., Chen,M., Chen,G., Wang,J.
            and Zhang,J.
  TITLE     Comparative phylogenetic analyses of recombinant noroviruses based
            on different protein-encoding regions show the
            recombination-associated evolution pattern
  JOURNAL   Sci Rep 7 (1), 4976 (2017)
   PUBMED   28694427
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7492)
  AUTHORS   Xue,L., Wu,Q., Cai,W. and Zhang,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2016) State Key Laboratory of Applied
            Microbiology Southern China, Guangdong Institute of Microbiology,
            No. 100, Xianliezhong Road, Yuexiu District, Guangzhou, Guangdong
            510070, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7492
                     /organism="Norovirus Hu/Guangzhou/GZ2013-L20/CHN/2013"
                     /mol_type="genomic RNA"
                     /isolate="Hu/Guangzhou/GZ2013-L20/CHN/2013"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1744851"
                     /country="China"
                     /collection_date="14-Nov-2013"
                     /note="genotype: GII.P12_GII.3"
     CDS             2..5098
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ASL69949.1"
                     /translation="MKMASNDASAAAAANSNNDNAKSSSDGVLSSMAVTFKRALGARH
                     KQPPPRETPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVWQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPVKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     SELKQALKNVAIKSCQIVYGGCTYRLESDGKGDVRVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEEIAKDGCP
                     KPQDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLVT
                     GSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSPS
                     LFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEGT
                     VVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGDC
                     GCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILGP
                     GSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPR
                     GRPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCWN
                     GESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLA
                     TMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKE
                     YGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPN
                     HEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5079..6725
                     /gene="VP1"
     CDS             5079..6725
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="major viral capsid protein"
                     /protein_id="ASL69950.1"
                     /translation="MKMASNDATPSNDGAAGLVPEINNEAMALDPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLVAMLYTPLRANNSGDDVFTVSCRVLTRPSPEFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTAGRFTPKLGSLEISTESDDFDQNQP
                     TRFTPVGIGVDHEADFQQWSLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRVQ"
     gene            6725..7489
                     /gene="VP2"
     CDS             6725..7489
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="minor viral capsid protein"
                     /protein_id="ASL69951.1"
                     /translation="MAGAFIAGLAGDIFTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPSATSTTSMSGGFTNQAVHRTTPNFKMNQAPKSTPSSGSSVRSLSTQVTSLSS
                     HSSGSSRSSGSTVASSLPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 aatgaagatg gcgtctaacg acgcttccgc tgccgctgct gccaatagca acaacgacaa
       61 cgcaaaatct tcaagtgacg gagtgctttc tagcatggct gtcactttta aacgagccct
      121 cggggcgcgg cataaacagc ctcccccgag ggaaacacca caaaggcctc cacggccacc
      181 caccccagaa ctggtcaaaa agatccctcc tcccccaccc aacggggagg atgagctagt
      241 ggtctcttac agcgccaaag atggcgtttc tggtttgcct gaacttacca ctgtctggca
      301 accggatgag accaacacgg cattcagtgt tccccctctc aaccagaggg agaacaggga
      361 cgccaaggag ccgctgaccg gaacaatcct ggaaatgtgg gacggggaga tctatcatta
      421 cggtctgtat gtggagcgag gccttgtact tggtgtgcac aaaccaccag ctgccatcag
      481 cctcgccaag gttgaactag caccactctc tctgttttgg aggccagtgt acacaccaca
      541 gtatctcatc tctccagaca ctcttaggag gctgcatgga gagtcgttcc cctacacagc
      601 ctttgacaac aactgctatg ccttctgttg ttgggttctg gacctaaacg actcgtggtt
      661 gtgcaggaga atgatccaga gaacaactgg cttcttcaga ccttaccaag aatggaacag
      721 gaagcccctc cccaccatgg atgactctaa attgaaaaag gtagccaaca tattcttgtg
      781 tgcgctatct tcgctattca ctaggcccgt caaagacata ataggaaaag tgagaccgct
      841 caacatcctt aacatcctgg cctcatgtga ttggactttt gcaggcatag tggaatcttt
      901 gatcctcttg gcagagctct ttggagtttt ctggacaccc ccagatgtgt ctgcgatgat
      961 cgccccctta ctaggtgact acgaactgca ggggcctgag gaccttgcag tggaactcgt
     1021 accagtagtg atgggaggga ttggtttggt gttaggattc accaaagaga agatcggaaa
     1081 aatgttgtca tctgctgctt ccaccttaag agcttgtaaa gaccttggtg catacggact
     1141 ggaaatccta aaattggtca tgaaatggtt cttcccaaag aaagaggaag caaatgagct
     1201 agctatggtg aggtccattg aggatgcggt gctggacctc gaagcaattg agaacaacca
     1261 catgactgcc ctcctcaaag acaaagacag cttggcaacc tacatgagga cccttgacct
     1321 cgaggaggag aaagccagga agctttcaac caagtctgct tcacctgaca tcgtgggcac
     1381 aatcaacgct cttctggcga gaatcgccgc tgcacgttcc ctggtgcatc gggcgaaaga
     1441 ggaactctcc agcagaccaa gacctgttgt tgttatgata tcaggtaggc cagggatagg
     1501 gaaaactcac cttgccaggg agctagccaa gaagatcgca gcttcgctca caggggacca
     1561 gcgcgtgggc ctcatccctc gcaatggcgt tgaccactgg gatgcataca agggagaaag
     1621 agtcgtccta tgggacgatt atggaatgag caatcccatc cacgacgccc tcaggttaca
     1681 ggaacttgct gacacctgcc cccttacgct aaactgtgac aggattgaga acaaaggaaa
     1741 ggtctttgac agtgatgcca taatcatcac cactaatcta gccaacccag caccattgga
     1801 ctatgtcaac tttgaagcat gctcgaggcg cattgacttc ctcgtgtacg cagaagcccc
     1861 tgaggtcgag aaagcaaagc gtgatttccc aggacaacct gacatgtgga agaacgcatt
     1921 tagctctgac ttctcgcaca taaaactggc gctggctccg caaggtggtt tcgacaagaa
     1981 cggaaacacc ccacacggga aaggcgttat gaaaactctc accactggtt ccctcatcgc
     2041 ccgagcatca gggctactcc atgagaggtt agatgagtac gagctgcagg gcccaactcc
     2101 caccaccttt aattttgacc gcaacaaggt gcttgcgttc agacaacttg ctgccgaaaa
     2161 caagtacgga ttgttggaca caatgagagt tggaaaacag ctcaaggatg ttaagaccat
     2221 gtcagagctc aaacaggcac tcaagaatgt cgcaatcaag agttgtcaga tagtgtatgg
     2281 tggctgcacc tacaggcttg agtctgatgg caagggtgat gtaagagttg acagagttca
     2341 gaacgccact gtacagacca acaatgagct tgccggcgca ctacaccatc ttaggtgcgc
     2401 cagaatcaga tattatgtca agtgtgttca ggaggccctg tattccatca tccaaattgc
     2461 tggggctgca tttgttacca cgcgcattgt caagcgcatg aacatacaag atctctggtc
     2521 caagccacag gtggaggata cagaggaaat cgctaaggat gggtgcccaa aaccccagga
     2581 tgatgaagaa tttgttgtct catccgatga catcaaaacc gagggcaaga aagggaagaa
     2641 caagtctggc cgtggcaaga agcacacagc attctcaagt aaaggtctca gtgatgaaga
     2701 gtacgatgag tacaaaagaa tcagagaaga aagaaatggc aaatactcca tagaggaata
     2761 cctccaggac agagacaggt attatgagga ggtggccatc gccagggcaa ccgaagagga
     2821 cttctgtgaa gaagaagagg ccaagatccg acagaggatc ttcaggccaa caaggaaaca
     2881 acgcaaagag gagagagcct ctctcggttt ggtcacaggt tctgaaatca ggaagaggaa
     2941 cccagacgac ttcaagccta aaggaaagct gtgggcagat gatgacagga gtgttgacta
     3001 caatgagaga ctcaattttg aagccccacc aagcatctgg tcgaggatag tcaactttgg
     3061 ctcaggttgg ggcttttggg tttcccccag cctgttcata acatcaactc atgtcatacc
     3121 ccagggcgca caggagttct ttggtgtacc catcaaacaa attcagatac acaaatcagg
     3181 tgaattctgc cgcttgaggt ttccaaaacc gatcagaact gacgtgacag gcatgatctt
     3241 agaagaaggt gcacccgaag ggaccgtggt cacattactc atcaaaagac caactggaga
     3301 gctcatgccc ctggcagcca gaatgggaac ccacgcaacc atgaagatac aagggcgcac
     3361 tgttggaggt caaatgggca tgctcctaac aggatccaac gccaagagta tggacctggg
     3421 caccacacca ggtgactgtg gctgccccta catttacaag agggggaatg actacgtggt
     3481 cattggggtc cacacagctg ccgcccgtgg aggaaacact gtcatttgtg ccacccaggg
     3541 gagcgaggga gaagccacac ttgaaggcgg tgatagcaag gggacctact gcggtgcacc
     3601 aatcttaggt ccaggaagtg ccccaaaact cagcaccaag accaagttct ggaggtcatc
     3661 cacggcacca ctcccacctg gtacctatga accagcttac ctcggcggca aggaccccag
     3721 agttaagggt ggcccttcac tgcaacaagt tatgagggat caactgaaac cattcactga
     3781 gcctaggggt aggccaccaa aaccaagtgt gctagaagct gccaagaaaa ccatcgtcaa
     3841 tgtccttgaa cagacaattg acccacctca aaaatggtcg tttgcgcagg catgcgcatc
     3901 ccttgacaag accacttcta gcggtcatcc gcaccacatg cggaagaacg actgctggaa
     3961 cggggagtcc tttacaggaa aattggcaga ccaggcttcc aaggccaacc tgatgtttga
     4021 ggagggaaag aacatgaccc cagtttacac gggtgcgctt aaggacgagc tggtcaagac
     4081 tgacaagatt tatggtaaga tcaaaaagag gcttctctgg ggttcggacc tggcgaccat
     4141 gattcggtgc gctcgagcat tcgggggtct gatggaggaa ctcaaagcac attgtgtcac
     4201 actacctgtt agggtgggta tgaatatgaa tgaggatggc cctatcatct ttgagagaca
     4261 ctccagatat aaatatcatt atgatgctga ctactcccgg tgggattcaa cacaacaaag
     4321 agccgtgttg gcagcagcct tagaaatcat ggtcaagttt tccccagagc cgcacctggc
     4381 ccaaaaggtt gcagaagacc ttctttctcc cagcgtgatg gacgtgggtg acttcaaaat
     4441 atcaatcaat gagggtctcc cctccggagt gccctgcacc tcccaatgga attccatcgc
     4501 ccactggctc ctcactctct gtgcactctc cgaggttaca aacctgtccc ctgacattat
     4561 tcaggccaac tctctctttt ctttctacgg tgatgatgaa attgtgagta cagacataaa
     4621 attggaccca gaaaaactga cagcaaaact taaggaatac gggttgaaac cgacccgccc
     4681 tgacaagaca gaagggcctc ttgtcatttc cgaagacctg aatggcctaa ccttcctgcg
     4741 gaggaccgtg actcgcgacc cagcaggctg gtttggaaag ttggaacaga gctcaatact
     4801 cagacaaatg tactggacta ggggccccaa ccatgaagat ccatctgaaa caatgatacc
     4861 acactcccag aggcccatac aattgatgtc tttgctgggt gaggcagcac tccacggccc
     4921 agcattctac agcaaaatca gtaaactggt cattgcagag ttgaaggaag gtggcatgga
     4981 tttctacgtg ccaagacaag agccaatgtt cagatggatg agattctcgg atctgagcac
     5041 gtgggagggc gatcgcaatc tggctcccag ttttgtgaat gaagatggcg tcgaatgacg
     5101 ccactccatc taatgatggt gccgccggcc tcgtcccaga gatcaacaat gaggcaatgg
     5161 cgctagatcc agtggcgggt gcagcgatag cagcacccct cactggccag caaaatataa
     5221 ttgatccctg gattatgaat aattttgtgc aagcacctgg tggtgagttc acagtgtctc
     5281 ctaggaattc ccctggtgaa gtgctcctca atttggaatt gggcccagag ataaacccct
     5341 atctggccca tcttgctaga atgtataatg gttatgcagg tgggtttgaa gtgcaggtag
     5401 tcctagctgg aaatgcgttt acagcaggaa agataatctt tgcagctata ccccctaact
     5461 tcccaattga caatctaagt gcagcacaga tcacaatgtg cccacatgtg attgtggatg
     5521 tcaggcagtt ggaaccggtc aacctcccga tgcctgacgt tcgcaataac ttcttccact
     5581 acaaccaagg gtctgattcg agattgcgct tggttgcaat gctgtacaca cctcttaggg
     5641 caaacaactc tggggatgat gttttcactg tgtcttgtag agtgctgact agacctagcc
     5701 ctgaattttc atttaacttc cttgtgccac ccactgtgga gtcaaaaaca aaacccttca
     5761 ctctcccaat tctgactatc tctgaaatgt ctaattctag gtttccagtg ccgattgatt
     5821 ctctgcacac cagcccaact gagaatattg ttgtccagtg ccaaaatgga cgcgtcactc
     5881 ttgatggtga gttgatgggc accactcagc tcttacctag tcaaatctgt gctttcaggg
     5941 gcgtgctcac tagatcaaca agcagggcta gtgaccaggc cgacacagca acccctagat
     6001 tgtttaatta ttattggcat atacaattgg ataatctaaa tgggactcct tatgatcctg
     6061 cagaagacat accaggcccc ctggggacac cagatttccg gggcaaagtc tttggcgtgg
     6121 ccagccaaag aaaccccgac agtacaacta gagcacatga agcaaaggtg gacacaacag
     6181 ctggtcgctt caccccaaaa ctaggctcat tagagatatc cactgaatct gatgactttg
     6241 accaaaacca accaacaaga ttcaccccag ttggcattgg ggttgaccac gaggcagact
     6301 tccaacaatg gtccttaccc gactactctg gccagttcac tcacaacatg aacttagccc
     6361 cagctgttgc tcccaacttc cctggtgagc agctcctttt cttccgctca cagttaccat
     6421 cttctggtgg gcgatccaat gggattctag actgcctggt cccccaagaa tgggttcagc
     6481 acttctacca agaatcagcc cccgcccaaa cccaggtggc tctggttaga tatgtcaacc
     6541 ctgacactgg tagagtgttg tttgaggcca agctgcacaa attaggtttc atgactatag
     6601 ctaagaatgg tgactctcca ataactgtcc ccccaaatgg atactttagg tttgaatctt
     6661 gggtgaaccc attttataca cttgccccca tgggaactgg gaatgggcgt agaagagttc
     6721 aataatggct ggagctttta tagcaggatt agctggtgat atattcacaa atactgtagg
     6781 gtctctagtt aatgcagggg ctaatgctat taatcaaaaa gttgattttg aaaataataa
     6841 atatttgcaa aatgcttcct tcaatcatga taaggaaatg ttaaatgcac agattgaggc
     6901 aacaaagagg ttacaggctg acatgattgc tatcaaacag ggggttttga ccgctggcgg
     6961 cttttccccc actgatgcag ctcgcggggc aattaatgcc cccatgacaa aagtcctaga
     7021 ttggaatgga acaaggtact gggcaccaag tgccacctct acaacctcga tgtcgggtgg
     7081 cttcacaaat caggctgtgc acagaaccac gccaaatttt aaaatgaacc aggcccccaa
     7141 atccacaccc agcagtgggt cttcagtgag gtcactctca acccaagtca ctagtctgag
     7201 ctcacactcg tccgggtcgt ctcgatccag cgggtctaca gttgctagct cattaccatc
     7261 ctctaacagg actagggact gggtcaatca gcaaaatttc aatttggaac cacacatgcc
     7321 tgggtcactt aggacggctt ttgtcactcc accatctagt acagcctcta gttcaggcac
     7381 tgtctcaacc gtgcccaaaa atgttttgga ctcctggaca tctgcgttta acacgcgcag
     7441 acagccgcta ttcgcacacc ttcgtagaag gggggagtca aatgtttagt ga
//