Typing tool

Complete norovirus genomes

KY210980  GII.4 Sydney
 GII.P16

Length: 7,577 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       KY210980                7577 bp    RNA     linear   VRL 17-APR-2020
DEFINITION  Norovirus GII strain
            Hu/GII.P16-GII.4/RUS/Novosibirsk/NS16-C38/2016, complete genome.
ACCESSION   KY210980
VERSION     KY210980.3
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7577)
  AUTHORS   Zhirakovskaia,E.V., Tikunov,A.Y., Sokolov,S.N., Kravchuk,B.I.,
            Krasnova,E.I. and Tikunova,N.V.
  TITLE     Characterization of the complete genome sequence of the recombinant
            norovirus GII.P16/GII.4_Sydney_2012 revealed in Russia
  JOURNAL   Vavilovskii Zhurnal Genet Selektsii 24 (1), 69-79 (2020)
REFERENCE   2  (bases 1 to 7577)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-NOV-2016) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
COMMENT     On Apr 23, 2019 this sequence version replaced KY210980.2.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7577
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P16-GII.4/RUS/Novosibirsk/NS16-C38/2016"
                     /isolation_source="feces"
                     /host="Homo sapiens; sex: M; age: 3 M"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="May-2016"
                     /note="genotype: GII.P16/GII.4_Sydney 2012"
     gene            1..5100
                     /gene="ORF1"
     CDS             1..5100
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ATD10879.2"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRGEPQKPPRPPTPELVNRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYRGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLMDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     1..996
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     997..2094
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2095..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3024
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3025..3567
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3568..5097
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5081..6703
                     /gene="ORF2"
     CDS             5081..6703
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="ATD10880.2"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPIGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRVV"
     gene            6703..7509
                     /gene="ORF3"
     CDS             6703..7509
                     /gene="ORF3"
                     /codon_start=1
                     /product="minor capsid protein VP2"
                     /protein_id="QCE20631.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSSLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGPSNKSS
                     NSSTATSVYSNQTISTRLGSTAGSGTSVSSLPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7510..7556
ORIGIN      
        1 atgaagatgg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaag
       61 gaaaaatctt caggtgaagg cttattcaca aatatgtctt ccaccttaaa gaaagccctc
      121 ggggctaggc ccaaacagcc tgccccgaga ggcgaaccac aaaagccccc aagaccacca
      181 actcccgagt tggtcaatag gataccccct cctccaccta atggcgaaga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg atctctggcc tgcccgagct cacaacggtc
      301 ccccaaccgg acgtggccaa cacagcattc agtgttccac cactgagctt gagagaaaac
      361 agggaggcca aggaaccgtt aacaggggca atattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtacgtgga gaaaggctta gtgttgggtg tgcacaaacc acctgcagcc
      481 ataagcatgg caagagtgga gctgacgccg ctgtcattgt actggcgtgt ggtgtacact
      541 ccccaatacc ttatctcccc tgaaactctc aggaggctca acggagaggc gttcccttac
      601 accgcctttg acaacaactg ttatgccttt tgctgttggg tgttagacct caatgactca
      661 tggcttagca ggaggatggt gcaaagaaca acgggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcccac catggatgac tccaaaatta agaaggtagc aaatatattc
      781 ctatgttcat tgtccacatt attcaccaga cccataaaag acctcatagg aaaaattaaa
      841 ccattaaaca tattgaacat cctggcaacg tgtgactgga cgtttgccgg aatagtggag
      901 tctctgatat tacttgctga actcttcgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttactcgg ggactacgag ttgcaagggc cagaagacct cgccgttgaa
     1021 ctcgtacctg tggtaatggg agggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaaca cttagggctt gcaaagatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga ggaggccaat
     1201 gagctagcca tggtgagggc catagaggat gccgtactag atcttgaggc aatagaaaat
     1261 aaccacatga caaccctgtt gaaagacaaa gacagcttag caacatacat gaaaacactg
     1321 gacatggagg aggagaaagc cagaaggttg tccacaaaat ctgcatcccc tgacatagtt
     1381 gggacaatca acgccctgct ggctcgaata gcagcggcca ggtcattagt ccacagggcc
     1441 aaggaagagc tatctagcag gataagacca gtagttgtta tgatatctgg caaaccagga
     1501 ataggcaaaa ctcatctggc cagggaggtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcggactcat accaagaaac ggtgtggacc attgggatgc atacagaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagtaacc ctattcatga tgctcttcgc
     1681 atacaggaat tggctgatac gtgtcccctt accttaaatt gtgacagaat tgagaataag
     1741 ggaaaagttt ttgacagtga agtcataata atcacaacaa accttgccaa tccagcccca
     1801 cttgattatg tcaactttga ggcctgttcc aggagaattg atttcctggt gtacgctgag
     1861 gcaccagaag tagaaaaggc aaaacgggac tttcctggtc agccagatat gtggaaggac
     1921 gccttcaagc cggacttttc acacatcaag ctacagcttg cacctcaggg cggttttgac
     1981 aagaatggca acaccccaca tgggaaagga gtgatgaaga ccctcactac cggttctctg
     2041 attgcccgtg catcaggcct actgcatgag aggatggatg aatttgaact ccaaggtccc
     2101 acaatcacca ccttcaattt cgaccggaac agaatcacag cattcagaca attggctgca
     2161 gaaaacaagt atggattgat ggataccatg aaagttggca atcaactaaa aggagtgaaa
     2221 accatggaag aactcaaaca agcaatcagg aatgtgacca tcaagaggtg ccggatcatc
     2281 tacggtggct ccacgtatga ccttgaatct gatggcaagg gcaaagtttt ggtggaaaag
     2341 gtcaagaaca cctctgtaca gaccaacaac gagttggccg gggccctgca ccatctcaaa
     2401 cacgcccgaa tcaggtacta tgtcaaatgt gtgcaagaag cagtctattc catcatacaa
     2461 attgccggcg ctgcgtttgt caccacgcgc attgcacgcc gcatgaacat acaagaactc
     2521 tggtcgaagc cacaattaga tcaaaatgaa tcagagacta aggaagaggc ccccaagtca
     2581 gaagatgacg agttcatcat atcttctaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aacaaaactg gccgcggcaa gaaacacact gcattctcca gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaatg ggaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gagctcgcca ttgccaaggc cacggaagaa
     2821 gacttctgtg aagaggagga aatcaaaatc cgtcagagaa ttttccgtcc caccaggaaa
     2881 caaagaaagg aagagagggc cacattaggg ttagtaacag gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc caaagggaag ctgtgggccg atgacaacag aagtgttgac
     3001 tacaatgaga aactagactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggttctggct ggggcttctg ggtatcacca agcctgttca taacatcaac tcatgtaatc
     3121 cctgcaggca taacagaagc atttggagtc cccattaaac aaattcagat ccacaaatca
     3181 ggtgaatttt gccgattcag attcccaaaa ccaattagac cagatgtgac aggaatgatt
     3241 ttggaagaag gtgcgcctga aggcaccgtg gcaactgtgc tcatcaaacg ccccaccgga
     3301 gagctcatgc ctcttgcagc cagaatggga acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacaaatggg tatgttgctc actggatcaa atgctaaagg aatggatttg
     3421 ggaacaactc ctggtgactg tggctgtcct tacatctata aaaggggcaa tgactatata
     3481 gtcattgggg tgcatactgc agcagcccgt ggcggaaaca ccgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccattctag gccctggggg tgcaccaaaa ttgagcacca aaaccaaatt ttggaggtca
     3661 tcgaacacgc cccttccacc agggacatat gagcctgcct acctcggtgg ccgtgatccg
     3721 cgtgttaagg gtgggccctc cttgcagcag gtaatgagag accaattgaa gccattcact
     3781 gaacccaggg gcaaacctcc aaggccaagt gtattggaag cagccaaaca aaccattatc
     3841 aatgtcctcg aacaaaccct ggaccctcca caaaaatgga catacgcaca ggcgtgtgcc
     3901 tcacttgaca aaaccacctc cagcgggcat ccccatcacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg taaattggca gaccaagcat caaaagcaaa cctaatgttt
     4021 gaggaaggga aacacatgac accagtgtat acagcagcac tcaaggacga gctagtcaag
     4081 actgagaaaa tctatggaaa gatcaagaag agactgctct ggggctctga cttgtccacc
     4141 atgatccggt gcgctaggtc atttggtggg ctcatggatg agatgaaggc acactgcata
     4201 tcactcccag tacgagtcgg catgaatatg aatgaagatg gcccaataat atttgagaaa
     4261 cattccagat acaaatacca ctatgatgca gactactctc gttgggattc aacacaacag
     4321 agggcagtac tagcagcagc cttggaaatc atggtcagat tctctgcaga accacaattg
     4381 gcacaaatag tcgctgagga tctgctggcc cctagtgtag tagatgtagg agactttaaa
     4441 atcacaataa atgaagggct cccatctggt gtgccatgca cttctcaatg gaactccatc
     4501 gcacactggt tgctaactct ctgtgccttg tctgaagtca ccaaactgtc ccctgacatt
     4561 atacaagcaa attccatgtt ctcattttac ggtgatgacg agattgtcag caccgacata
     4621 aaattggacc ctgaacagtt aaccgccaaa ttgaaggagt acggcctgaa accaacccgc
     4681 ccagacaaga ccgagggacc cctgatcatc agtgaagatt tgaacggact cactttcctc
     4741 cgaaggacgg taactcgtga cccagctggc tggtttggaa aactggacca aagctcaatt
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgaag accccaatga gacaatgata
     4861 ccccattctc aaagacccat acagctcatg gcactgcttg gtgaagcctc tcttcacgga
     4921 ccctctttct acagtaaaat cagtaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg cgtcgagtga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtacca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgttg gtgccgctat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggggagt ttacagtgtc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ctaggccctg acctaaatcc
     5341 ctacctatcc catttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aattctcgcg gggaacgcgt tcaccgccgg gaagatcata tttgcagcag tcccaccaaa
     5461 ttttccaact gaaggcttaa gtcctagcca ggtcactatg ttcccccata taatagtaga
     5521 tgttagacaa ttagaacctg tgctgattcc cttacctgat gtcaggaata atttctatca
     5581 ttacaatcag tcaaatgact ccactattaa gttgatagca atgttgtata caccacttag
     5641 ggctaataat gctggggatg atgttttcac agtttcgtgc cgagttctca cgagaccatc
     5701 ccccgatttt gatttcatat ttttagtgcc acccacagtt gagtcaagaa ctaaaccatt
     5761 ctctgtccca gttttaactg ttgaggagat gaccaattca agattcccca ttcctttgga
     5821 aaagttgttc acgggcccca gcagtgcctt tgttgttcaa ccacaaaacg gcaggtgcac
     5881 aactgatggc gtgctcctag gcaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccacatca caggtagtcg caactacaca atgaatttgg cttctcaaaa
     6001 ttggaacaac tatgacccaa cagaagaaat cccagcccct ttaggaactc cagattttgt
     6061 ggggaagatt caaggcatgc tcacccaaac cacaagaaca gatggttcaa cacgcggcca
     6121 caaagctaca gtgtacactg ggagcgccga ctttgctcca aaactgggta gagttcaatt
     6181 tgaaactgac acagaccatg attttgaagc taatcaaaac acaaagttca ccccaatcgg
     6241 tgtcatccaa gatggtagca ccacccaccg gaacgaaccc caacagtggg tgctcccaag
     6301 ttactcaggc agaaatactc acaatgtaca tctggccccc gctgtagccc ccacctttcc
     6361 gggtgagcaa cttctcttct tcagatccac catgcccgga tgcagcgggt accccaacat
     6421 ggatttggac tgtctgctcc cccaggaatg ggtgcagtac ttctaccaag aggcagcccc
     6481 agcacaatct gatgtggctc tgctaagatt tgtgaatcca gacacaggta gggttttgtt
     6541 tgagtgcaag cttcacaaat caggctatgt tacagtggct cacactggcc aacatgattt
     6601 ggttatcccc cccaatggtt actttaggtt tgattcctgg gtcaaccagt tctacacgct
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgtagta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttggctct ggacttggtt cccttatcaa tgctggggct
     6781 ggggccatca accaaaaagt tgagtttgaa aataacagaa aattgcaaca agcatccttc
     6841 caatttagca gcagtctgca acaggcttcc tttcaacatg ataaagagat gctccaagca
     6901 caaattgagg ccaccaaaaa gctacaacag gaaatgatga aagttaagca ggcaatgctc
     6961 ctagagggtg ggttctctga gacagatgca gcccgcgggg caattaacgc ccccatgaca
     7021 aaagctttgg actggagcgg gacaaggtac tgggctcccg atgctaggac tacaacatat
     7081 aatgcaggcc gcttttccac ccctcaacca tcgggggcac tgccaggaag agctaatctt
     7141 agggatgctg tccctgctcg gggaccctcc aacaaatctt ctaactcttc tactgccacc
     7201 tctgtgtact caaatcaaac tatttcaacg agacttggtt ctacagctgg ttctggaacc
     7261 agtgtctcga gcctcccgtc aactgcaagg actaggagct gggttgagga tcaaagtagg
     7321 aatttgtcac ctttcatgag gggggcccac aacatatcat ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag agattttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgggtgtaat gtgaaaagac aaaactgatt atctttcttt ttctttagtg tcttttaaaa
     7561 aaaaaaaaaa aaaaaaa
//