Typing tool

Complete norovirus genomes

KY210920  GII.13
 GII.P16

Length: 7,506 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6710
ORF3: 6710..7441
LOCUS       KY210920                7506 bp    RNA     linear   VRL 16-APR-2020
DEFINITION  Norovirus GII isolate
            Hu/GII.P16-GII.13/RUS/Novosibirsk/NS16-A397/2016, complete genome.
ACCESSION   KY210920
VERSION     KY210920.3
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7506)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Molecular epidemiology of norovirus associated with sporadic
            gastroenteritis in Russia
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7506)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-NOV-2016) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
REFERENCE   3  (bases 1 to 7506)
  AUTHORS   Zhirakovskaya,E., Tikunov,A. and Kravchuk,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
  REMARK    Sequence update by submitter
COMMENT     On Apr 22, 2019 this sequence version replaced KY210920.2.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7506
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.P16-GII.13/RUS/Novosibirsk/NS16-
                     A397/2016"
                     /isolation_source="feces"
                     /host="Homo sapiens; sex: M; age: 87 Y"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="24-Jun-2016"
                     /note="genotype: GII.P16/GII.13"
     5'UTR           1..4
     gene            5..5101
                     /gene="ORF1"
     CDS             5..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ATD10759.2"
                     /translation="MKMASNDATVAVACNSNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNSQKPPRPPTPELVKRIPPPPPNGEEEEPVIRYEVKNGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVE
                     KAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRIAAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVIIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIVRRMNIQELWSKPPLDQNELEAKEEA
                     PKSEDDEFIISSRDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRSDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPYHVRKNEFWN
                     GETFTEKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..997
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     998..2095
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2096..2626
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2627..3025
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3026..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5082..6710
                     /gene="ORF2"
     CDS             5082..6710
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="ATD10760.2"
                     /translation="MKMASNDAAPSNDGAASLVPEAINETMPLEPVAGASIAAPVAGQ
                     TNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAIPPNFPVDMISPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNVFYHFNNQPQPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFIYLVPP
                     SVESKTKPFTLPILTISELTNSRFPIPIEQLYTAPNENNVVQCQNGRCTLDGELQGTT
                     QLLSSAVCSYRGRTVANHGDNWDQNLLQLTYPSGASYDPTDEVPAPLGTQDFSGILYG
                     VLTQDNVSEGTGEAKNAKGVYISTTSGKFTPKIGSIGLHSITENVHPNQQSRFTPVGV
                     AQNENTPFQQWVLPHYARALALNTNLAPAVAPTFPGEQLLFFRSRVPCVQGLRGQDAF
                     IDCLLPQEWVNHFYQEAAPSQADVALIRYVNPDTGRTLFEAKLHRSGFITVSHTGAYP
                     LVVPPNGHFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6710..7441
                     /gene="ORF3"
     CDS             6710..7441
                     /gene="ORF3"
                     /codon_start=1
                     /product="minor capsid protein VP2"
                     /protein_id="QCD16866.1"
                     /translation="MAGAFIAGLAGDMLTSAVGSLTSAGANAINQKLNFDYNKQLQNA
                     SFQHDKEMLQAQIDATKKLQSEMIAIKHGVLTAGGFSPADAARGAVNAPMTRVLDWSG
                     TRYYAPNSVQTTSYSGQFTPSPVHRAQVKPPSNSSQRTAAPSSIRSMSTQSTSLGSTS
                     SGGSSTASSSSRTADWVQQQRALSPYMQGALQTAYVTPPSSRASSMSSVSTVPKGVLD
                     SWTPVFNTRRQPLFAHLRKRGESQA"
     3'UTR           7442..7506
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca gcaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggcc cggcccaaac agcctgcccc gagggacaac tcacaaaagc ccccaagacc
      181 accaactccc gagttggtta agaggatacc ccctccccca cctaatggtg aagaagaaga
      241 accagtcatt aggtatgagg ttaagaatgg aatctctggc ctgcccgagc tcacaacagt
      301 ccctcaaccg gatgtggcca acacggcatt cagtgtccca ccgctgagct tgagagaaaa
      361 cagggaggcc aaggaaccgc tgacaggggc aatattagag atgtgggatg gagagatata
      421 ccactatggc ctgtacgtgg aaaaaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 tataagcatg gcaaaagtgg agctgacgcc gctgtcattg tattggcgtg tggtctacac
      541 cccccaatac ctcatctccc ctgaaactct caggcggctc aacggagagg cattccctta
      601 cactgccttt gacaacaact gctatgcctt ttgctgctgg gtattagacc tcaatgactc
      661 atggcttaac aggaggatgg tgcaaagaac aacaggcttc ttcagacctt accaagagtg
      721 gaacagaaaa cccctgccca ctatggatga ctccaaaatc aagaaggtgg caaacatatt
      781 cctgtgttca ttatccacgt tgttcaccag acctataaaa gacctcatag gaaaaattaa
      841 accattaaac atcttgaaca tcctggcaac gtgtgactgg acattcgccg gaatagtgga
      901 gtctctgata ttacttgctg aactctttgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cctttacttg gagactacga gttgcaaggg ccagaagacc ttgccgttga
     1021 gctcgtgcct gtagtaatgg gagggattgg tttggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcatcaac gctcagggct tgtaaagatc ttggtgccta
     1141 tggtttagag atactcaaat tggtcatgaa gtggttcttc ccaaagaaag aagaggccaa
     1201 tgagctagcc atggtgagag ctatagagga tgctgtactg gatcttgagg caatagaaaa
     1261 taatcacatg acaactctgt tgaaagacaa agacagccta gcaacctaca tgaaaacact
     1321 agacatggag gaggaaaaag ccagaagatt gtccacaaag tctgcatccc ctgacatagt
     1381 tgggacgatc aacgccctgc tggctcgaat agcagcggct aggtcattag tccacagggc
     1441 caaggaggag ttatctagca ggataagacc agtggttgtt atgatatctg gcaaaccagg
     1501 gataggcaaa actcatttgg ccagggaggt ggcaagaaag gtggcatcca ctctcacagg
     1561 ggatcaaaga gtcgggctca taccgagaaa cggtgtggac cattgggatg catacaaagg
     1621 tgagagagtc gtgctgtggg acgactatgg catgagcaac cccattcatg atgctctgcg
     1681 catacaagaa ctggctgata cgtgtcccct taccttaaat tgtgacagaa ttgaaaataa
     1741 gggaaaagtt tttgacagtg aagtcataat aatcacaaca aaccttgcca atccagctcc
     1801 acttgattat gtcaactttg aggcctgttc caggagaatt gacttcctgg tgtacgccga
     1861 tgcaccagaa gtagaaaagg caaaacgaga ctttcctggt caaccagata tgtggaagga
     1921 cgccttcaag tcggactttt cacatatcaa gttgcaactt gcacctcagg gcggctttga
     1981 caagaatggc aacaccccac atgggaaagg agtgatgaag accctcacca ccggttccct
     2041 aatcgcccgt gcatcaggct tactgcatga gaggatggat gaatttgaac tccaaggccc
     2101 cacagtcacc accttcaatt ttgaccggaa cagaatcgct gcattcagac aattggctgc
     2161 agaaaacaag tatggattgg tggacaccat gagagttggc aatcaattaa aaggggtgaa
     2221 aaccatggaa gaactcaaac aagcaatcaa gaatgtgatc atcaagaggt gccggatcat
     2281 ctacggtggc tccacgtatg accttgaatc tgacggcaag ggcaaagttc tggtggaaaa
     2341 ggtcaagaac acctctgtac agaccaacaa cgagttggct ggagccctgc atcacctcaa
     2401 acatgcccga atcaggtact atgtcaaatg tgtgcaagaa gcagtctact ctattataca
     2461 aatcgccggc gctgcgtttg tcaccacacg catagtacgc cgcatgaaca tacaagagct
     2521 ttggtcgaag ccaccattag accaaaatga attagaggct aaggaagagg cccccaagtc
     2581 agaagatgac gagttcatca tatcttctag ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca agaaacatac tgcattctct agcaagggct tgagcgatga
     2701 ggagtatgac gagtacaaga ggataagaga agagagaaat ggaaagtact ctatagagga
     2761 gtaccttcaa gacagagaca ggtactatga ggaactcgcc atcgccaagg ccacggaaga
     2821 agacttctgt gaggaggagg agatcaaaat ccgtcagcgg atcttccgtc ccaccaggaa
     2881 gcaaaggaag gaagagaggg ccacactagg gctagtaact ggttcagaaa tcagaaaaag
     2941 aaaccctgat gacttcaaac ctaaagggaa actgtgggcc gatgacaaca gaagtgttga
     3001 ctacaatgag aaactggact tcgaggcccc cccaagcata tggtctagga ttgtgagttt
     3061 tggttctggt tggggcttct gggtgtcacc aagcctgttc ataacatcaa ctcatgtaat
     3121 ccctgcaggc ataacagagg catttggagt ccccatcaaa caaatccagg tccacaaatc
     3181 aggtgagttt tgccggttta gattcccaaa accaattagg tcagatgtga caggaatgat
     3241 cttggaagaa ggtgcgcctg agggcaccgt ggcaaccgtg ctcatcaaac gccctaccgg
     3301 agagctcatg ccccttgcag ccagaatggg aacacacgca accatgaaaa ttcagggccg
     3361 catggttggc ggacagatgg gtatgttgct cactggttca aatgctaaag gaatggattt
     3421 gggaacaact cctggtgatt gtggctgtcc ctacatctac aaaaggggca atgactacat
     3481 agtcattggg gtgcacacag cagcagcccg tggtggaaac accgtcatct gtgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacgt actgtggggc
     3601 acccattcta ggccctgggg gggcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacacg cctcttccac cagggacgta tgaacctgcc tacctcggtg gccgtgaccc
     3721 gcgtgttaag ggtgggccct ccttgcagca ggtaatgaga gaccagttga agccattcac
     3781 tgagcccagg ggtaaacctc caagaccaag tgtgttggaa gcagccaaac aaaccatcat
     3841 caatgtcctc gaacaaaccc tggaccctcc acaaaaatgg acatacgcac aggcgtgtgc
     3901 ttcacttgac aaaaccacct ccagcgggca tccctaccac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg aaaaattggc agaccaagca tcaaaagcaa acctaatgtt
     4021 tgaggaaggg aaacacatga caccagtgta tacagcagcc ctcaaggatg agctggtcaa
     4081 aactgacaaa atctatggaa agattaagaa gagactgctc tggggctctg acttgtccac
     4141 catgatccgg tgcgccaggt cctttggtgg gctcatggat gagatgaaag cacactgcat
     4201 atcactccca gtccgagttg gcatgaacat gaatgaagat ggtccaataa tatttgagaa
     4261 gcactccaga tacaagtatc actatgatgc agattactcc cgctgggatt caacacaaca
     4321 gagggcagta ttagcagcag ccttggaaat catggtcagg ttctctgcag agccacaatt
     4381 ggcacaaata gtcgctgagg atctactggc ccccagtgtg gtagatgtag gagactttaa
     4441 aatttcaata aatgaagggc tcccctctgg tgtaccatgc acttctcaat ggaattccat
     4501 cgcacactgg ctgctaaccc tctgtgcctt gtctgaagtc accaaactgt cccctgacat
     4561 tgtacaggca aattccatgt tctcatttta cggtgatgac gagattgtca gcaccgatat
     4621 aaaattggat cctgaaaagt taaccaccaa attgaaggag tacggcctga aaccaactcg
     4681 cccagacaaa accgagggac ccctgatcat cagtgaggat ttgaacggac tcactttcct
     4741 ccggaggacg gtgactcgtg acccagctgg ctggtttgga aaattggacc aaagctcaat
     4801 attgaggcag atgtactgga ctagaggacc aaatcatgaa gaccccaatg agacaatgat
     4861 accccactct caaagaccca tacagctcat ggcactgctt ggtgaggcct cccttcacgg
     4921 accctctttc tacagcaaaa ttagtaagtt ggtcataact gaactcaaag aaggtggaat
     4981 ggacttttac gtgccaaggc aggaacccat gttcaggtgg atgaggtttt ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atcgaacgat ggtgcagcta gtctcgtacc agaggccatt aatgagacta
     5161 tgccattgga acccgttgct ggcgcatcta ttgctgcccc agtagcggga caaactaaca
     5221 taattgaccc ctggataaga acaaattttg tgcaagcccc taatggagag tttacagtgt
     5281 caccgagaaa ttcccctgga gagattctat taaatttaga gttaggacca gatttgaatc
     5341 cttatttggc ccatctatca aggatgtaca atggatatgc tggaggtgtt gaggtgcaag
     5401 tgcttcttgc tgggaacgcg ttcacagcag gaaagatatt atttgcagca atcccaccca
     5461 actttcctgt agatatgatt agtccagctc aaattactat gctcccccat ttgattgtag
     5521 atgttaggac attggaacct attatgatac ccttacctga tgttaggaat gtgttctatc
     5581 attttaataa tcaaccccaa cctaggatga gattagtggc tatgctctat accccattga
     5641 gatctaatgg ttcaggagat gatgtcttca ctgtgtcttg tagagtgtta actaggccaa
     5701 cccctgactt tgaattcatt tacctagtgc ctccctctgt agagtccaaa actaaaccat
     5761 tcacacttcc aatattgacc atttctgaac taaccaactc ccggtttccc atcccaattg
     5821 agcaactgta cacggcccca aatgagaata atgttgtaca gtgtcaaaat gggaggtgca
     5881 ccttggatgg agagcttcag ggcaccaccc agctgctgtc aagtgcagtt tgctcttaca
     5941 ggggcaggac tgtggctaac catggggaca attgggacca gaatttgctc cagctgacct
     6001 acccaagcgg tgcaagctat gaccccactg atgaagtacc agcacccttg ggcacccagg
     6061 atttcagtgg gatattgtat ggggtgttga cccaagacaa tgtaagtgag ggtacagggg
     6121 aggccaaaaa tgctaaggga gtatacatat ccaccaccag tggaaaattc accccaaaaa
     6181 ttgggtcaat tggattgcat tcaataactg aaaatgtgca ccccaatcag cagtcacggt
     6241 tcacccccgt tggagttgct cagaatgaaa acaccccctt ccagcaatgg gttctaccac
     6301 actacgcacg tgctctcgct ctaaacacca atttggcacc cgctgttgcc ccgactttcc
     6361 ctggcgagca attactgttc ttcaggtccc gtgttccatg tgttcaaggt ctgcgggggc
     6421 aggatgcttt catagattgt ctcctacctc aagagtgggt gaaccatttt tatcaagagg
     6481 ctgctccctc ccaagcagac gttgccctca tcaggtatgt caaccctgat actggtcgca
     6541 cgctgtttga ggccaaattg cacaggtcag gtttcattac tgtatcacac actggtgcct
     6601 accctcttgt ggtcccccca aatggtcatt tcaggtttga ttcttgggtt aatcaattct
     6661 actcactcgc ccccatggga actggcaatg ggcgtagaag agttcaataa tggcaggagc
     6721 atttatagct ggtctagccg gtgacatgct gacttctgct gttggttcac tgacctctgc
     6781 aggagccaat gccatcaatc agaaactgaa ttttgattac aataaacaac tccaaaatgc
     6841 atcctttcaa catgataagg aaatgttgca ggcccaaatt gatgctacaa agaagctcca
     6901 atcagaaatg attgcaatta agcatggggt tttgaccgcg ggcggctttt ccccagctga
     6961 tgcagccaga ggggcagtca acgccccaat gactcgagtg ttggattggt cagggacacg
     7021 ctactacgct ccaaattctg tgcaaaccac cagttattct gggcaattca ccccctcgcc
     7081 agtccatcgg gcgcaggtga agcccccttc caattcatcc cagcggactg cagctccaag
     7141 cagtatccgc agcatgtcaa cccaatcaac ttctttaggc tccacctcct caggggggtc
     7201 ctctacagcc tcctctagtt cgagaacagc agactgggtg caacaacaaa gggctcttag
     7261 cccgtacatg caaggagccc tgcagacggc atacgtcaca ccgccgtcta gtagggcctc
     7321 cagcatgagc tctgtctcaa cagtgcccaa aggggttttg gactcctgga cacctgtgtt
     7381 caacacacgc aggcagccgc tgtttgcaca cctcaggaag aggggggagt cacaggctta
     7441 gtgaaaagga taatcaactt ttaaatgtga ttttattttc cttttaaaaa aaaaaaaaaa
     7501 aaaaaa
//