Typing tool

Complete norovirus genomes

KX907731  GI.9
 GI.P9

Length: 7,681 | 3 CDS

ORF1: 5..5398
ORF2: 5382..7034
ORF3: 7034..7681
LOCUS       KX907731                7681 bp    RNA     linear   VRL 07-NOV-2016
DEFINITION  Norovirus Hu/USA/2016/GI.P9_GI.9/SC6350, partial genome.
ACCESSION   KX907731
VERSION     KX907731.1
KEYWORDS    .
SOURCE      Norovirus Hu/USA/2016/GI.P9_GI.9/SC6350
  ORGANISM  Norovirus Hu/USA/2016/GI.P9_GI.9/SC6350
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7681)
  AUTHORS   Collins,N., Aswath,K., Barclay,L. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-SEP-2016) NCIRD/DVD/GRVLB, CDC, 1600 Clifton Rd NE,
            Atlanta, GA 30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7681
                     /organism="Norovirus Hu/USA/2016/GI.P9_GI.9/SC6350"
                     /mol_type="genomic RNA"
                     /strain="Hu/USA/2016/GI.P9_GI.9/SC6350"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1914546"
                     /country="USA"
                     /collection_date="26-Jan-2016"
                     /note="genotype: GI"
     CDS             5..5398
                     /note="ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="APA31981.1"
                     /translation="MMMASNDAIAVADVSKNNANTNNENIGSRLMAKLKERISSQRGE
                     NTTKIKSTEMALELIRRSQTPSPTRPELPPKGQRDRPPRTVSEVKRTLGWDAPAHKDY
                     GARPWCELTAEEKKEILDNNERLFDAGGVTPSDVPSTFERSETIESLDDSHAVRWSET
                     AGVDLGVDSLTTVTGPVWNMCPLPPIESRNNGPAAEPHIGDMIEFYEGHIFHYAIYFG
                     QGKTIGVHSPQAAFSIARITIHPMAAWWRVCYVPTERQRLSYDQLKELENEPWPYASI
                     TNNCYEFCCRVMSLDDTWLQRKLVTSGKFNHPTQEWSKDTPDFHQDSKLEMVRDAILS
                     AINGLVSQPFKNILAKIKPLNLMSLLSNCDWTFMGVVEMVVLMAELFDIFWTPPDISN
                     FIASLLPDFHLQGPEDLARDLVPLILGGIGLAIGFTRDKVTKVMKSAVDGLRSATQLG
                     QYGLEIFSIIKKYFFGGDQTEKTLKGIENAVIDMEVLSSTNVTQLVRDKKLAKTYMNI
                     LDNEEEKARKLSVRSADPHVVTTVNNLISRISMARSALAKAQAEMTSRARPVVIMMCG
                     PPGIGKTKAAEHLANRLAGEIRPGGKVGLVPRESIDHWDGYHGEEVLLWDDYGMSKIT
                     EDCNKLQAIADTAPFTLNCDRIENKGMQFVSDAIIITTNAPGPAPVDFVNLGPVCRRV
                     DFLVYCTAPEIEQTRRTHPGDTNAIKDLFKKDFSHLKMEIAPQGGFDNQGNTPFGKGA
                     MKPTTLNRLLIQATALTMERQDEFQMQGAVYNFDEDRIAAFTNLARANGLGLLSMAAL
                     GKKLRSVNSMEGLRNALKGYKISECDIIWNNRTYTIKGDGSSVSISEKQVTTTLQQQA
                     ISSVTLALTRLRAARALAYASCFQSAVVTILQMAGSAVVISRAVKRMFGTHTNQPTLE
                     GKPKEHNCRVHRAEREGHGPIGHDGVIERYGLCESDQDEGKDLVELPTASQEGKNKGK
                     NKKGRGRKNNYNAFSRRGLSDEEYEEYKKVREEKGGNYSIQEYLEDRQRYEEELAEVQ
                     AGGDGGMGETEAEIRYRVFYKSKSGMRKQRQEERRQLGLVSGTEIRKRKPIDWTPPKN
                     DWSEDTREVNYDEHISFEAPPSIWSRVVKFGSGWGFWVSPTVFITTTHVIPPEAKEIF
                     GEKVSDIAIHRVGEFTQFRFSKKMRPDLSGMVLEEGCPEGTVCTIMIKRDSGELLPLA
                     VRMGAVASMKIQGKLMHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGV
                     HAAATKSGNTVVCAIQSGEGEATLEGGGQNKGHYAGHPILRYGNGPSLSTKTKFWKST
                     PQPLPPGTYEPAYLGGRDPRVEGGPSLQQVLRDQLKPFAEPRGRLPEPSLLEAAVETV
                     TNVLEQTMDTPIPWSYSDACMSLDKTTSSGFPHHKKKNDDWNGSTFVRELGDQAAHAN
                     NMYEMGKSMKPVYTAALKDELVKPEKVYTKVKKRLLWGADLGTVIRAARAFGPFCEAI
                     KPHVIKLPIKVGMNAIEDGPMIYAEHAKYKYHFDADYTAWDSTQNREIMLESFNIMCK
                     LTANPSLAAVVAQDLLSPSEMDVGDYVISVKDGLPSGFPCTSQVNSINHWIYTLCALS
                     EVTGLAPDVLQSQSYFSFYGDDEIVSTDVEFDPVKLTQVLKEYGLKPTRPDKSEGPII
                     VKQCVDGLVFLRRTISRDAAGYQGRLDRNSIERQLWWTRGPNHDDPFETLVPHQQRKI
                     QLISLLGEAALHGEKFYRKIANRVIQEVKEGGLELYVPGWQPMFRWMRFHDLSLWAGD
                     RNLLPDYVNDDGV"
     CDS             5382..7034
                     /note="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="APA31982.1"
                     /translation="MMMASKDATSNMDGTSGAGQLVPENNNTSEPINMEPVAGAVTAA
                     ATAGQVNMIDPWIMNNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYN
                     GWVGNMKVRVVLAGNAFSAGKIIVCCIPPGFSAPNISIAQATMFPHVIADVRVLEPID
                     IPLDDVRNVLFHNNDNGNQTMRLLCMLYTPLRSGGTSSGTDPFVIAGRVLTCPTPDFN
                     FLFLVPPTVEQKTKQFSVPNLPLNVMSNSRVPSLLNAMVVSPDQAQVVQFQNGRCTLD
                     GQMLGTTTVSASCVARFRGKTFQAPDNRLGINLAEISGEPYHAFESPAPLGFPDFGDG
                     DWHVTATKVTPSQLEANDPVVMGNVQPYNPQFAPHLGTLVVENPTPDNVTTGTDLLFN
                     ITWLSNRANNRFNPWVIPNYGSTLTEAAQLAPSIFPPGFGETIVYFNSTFPAVGATTH
                     AAIPCLLPQEFVAHFVNEQAPIRGEAALLHYIDPDTHRNLGEFKIYPEGFVTCVPNVG
                     GTGPQSLPTNGIFVFVSWVSRYYQLKPVGTAGQARRLGFRRV"
     CDS             7034..7681
                     /note="ORF3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="APA31983.1"
                     /translation="MAQAIFGAIAATAAGSAVSASIDAGTQAALQYQRYQQDLDLQSK
                     SFLHDERMLGLQVDASNALLQKNLSTRYNLLLSSGMSSSDAARMIAGAPPTKIVDWNG
                     VRVAAPRSSATTLRSGGFMPVASLSTTPKMKNDGAGIVNPNYAPSHSSMVSRTTQWVE
                     SQNSLRSLEPFHHGALQTAWVTPPGSSSTSTVSSVSTAPRYFNTERLPLFANLRK"
ORIGIN      
        1 gtgaatgatg atggcgtcta acgacgctat tgccgttgct gatgtcagca aaaacaatgc
       61 taacaccaac aatgaaaata ttggctctcg ccttatggcg aagctgaagg agcgaataag
      121 ctcccaacgt ggtgagaaca ccacaaaaat caagagcaca gaaatggcgc tcgaactaat
      181 acgtaggtct caaacaccat cacctacacg cccagaactg ccaccaaaag ggcaacgtga
      241 ccgccctcca aggacagtgt ccgaagtcaa acggacgtta ggttgggatg cccccgccca
      301 taaggattat ggagctcgtc catggtgtga actaacagca gaagagaaga aagagattct
      361 ggacaacaac gagcgtttat ttgatgctgg tggggtcaca ccctccgatg tgcctagcac
      421 tttcgagagg agtgagacaa ttgagagttt ggatgacagc catgcagtta gatggagtga
      481 aactgcagga gtggaccttg gcgtggattc cttgactacg gtcactggtc cagtttggaa
      541 catgtgccct cttcccccga ttgagtcgcg caataatgga cctgcagccg aaccacacat
      601 aggggacatg atcgagttct atgagggaca catttttcat tatgccatct actttggtca
      661 aggaaaaacc ataggagtgc actctcctca agcagccttt tcaatagcac gcattaccat
      721 acaccccatg gcagcatggt ggcgggtctg ctatgtgccc acagaacgtc agcgtctcag
      781 ctatgaccaa ctaaaagagc ttgagaatga accatggcct tacgcctcca taaccaacaa
      841 ctgctatgag ttttgctgcc gcgtgatgtc actcgatgac acatggttgc agcggaaact
      901 ggtaacatca ggcaagttca atcaccctac ccaggagtgg tccaaggaca caccagactt
      961 ccatcaagat tcaaaactgg aaatggtcag ggatgctatc ctatcggcaa taaatgggct
     1021 ggtctcccag cccttcaaaa acatcctagc aaaaattaaa ccactgaatc tgatgtctct
     1081 tttatcaaat tgtgactgga cctttatggg ggttgtggag atggtagtat tgatggctga
     1141 attgtttgac atcttctgga ccccacctga catttccaac tttatagctt ctcttttgcc
     1201 agatttccac ctacaagggc cagaggatct ggcaagggac ttggtcccgt tgatacttgg
     1261 gggtattggc ctggccattg gttttaccag ggataaagtc acaaaggtaa tgaagagtgc
     1321 tgttgatggt ttgcggtctg ctacacagct gggacagtat ggccttgaga tattttcaat
     1381 tatcaagaag tatttctttg gaggagatca aactgagaag actctcaagg gcatagaaaa
     1441 cgctgtgata gacatggaag tcctgtcaag caccaatgtg actcaactgg tgcgtgacaa
     1501 gaaactggct aaaacatata tgaatatatt agacaatgag gaagaaaaag cacgaaagct
     1561 ttcagtgcgc agtgctgacc cacatgtagt aacaacagtt aacaacctca tatcacgtat
     1621 atccatggca agatctgccc ttgctaaggc ccaggcagaa atgaccagcc gtgctcgccc
     1681 agtagttatc atgatgtgtg gaccaccagg cataggaaaa accaaggcag ccgagcacct
     1741 tgcaaaccgg ctagccggtg aaataaggcc aggaggtaaa gtcggactgg tgcccaggga
     1801 atccattgat cactgggatg ggtaccatgg ggaagaagtc ctattgtggg atgactatgg
     1861 catgtccaag ataacagaag actgcaataa gctacaggcc atagctgaca cagccccttt
     1921 cacactcaac tgtgacagaa tagagaacaa aggtatgcaa tttgtatcag atgcaatcat
     1981 aataactaca aatgcccctg gaccagcccc agttgacttt gtcaatcttg gaccggtgtg
     2041 ccggcgtgtg gactttctgg tgtattgcac tgcccctgaa atagagcaaa caagaaggac
     2101 ccaccccggg gacacaaatg ctattaagga tctattcaag aaagacttct cacacctaaa
     2161 aatggaaata gccccccaag ggggttttga taaccaaggc aacacacctt ttggaaaggg
     2221 tgcaatgaag ccaaccacac ttaacaggct gcttatccag gccaccgcgt tgaccatgga
     2281 gaggcaagat gagttccaga tgcagggggc cgtctacaac tttgatgagg accggatagc
     2341 agctttcacc aatctagctc gtgccaatgg attgggcctc ttgagtatgg cggccctcgg
     2401 gaagaaactg cggagtgtca acagcatgga gggacttcgt aatgccctta aagggtacaa
     2461 aatttctgaa tgtgacatta tatggaacaa caggacctat accatcaaag gtgatgggtc
     2521 aagtgtgagt atatcagaaa aacaagtgac caccacccta caacaacaag ctattagttc
     2581 ggtaaccctg gcactcacca gattgcgcgc tgcccgtgca ttagcatatg catcctgctt
     2641 ccagagtgcg gtggtcacta tcttgcagat ggcaggttct gcagtggtca ttagcagggc
     2701 agttaaacgc atgtttggga cccacaccaa ccaaccaaca ctagagggaa aacccaaaga
     2761 gcacaattgc agagtccacc gagctgaaag agaaggtcat ggccccatag gtcacgatgg
     2821 tgttattgaa cgctacggcc tgtgtgaaag tgaccaggat gaaggaaagg atttagtaga
     2881 actgccaacg gccagccaag agggcaagaa caaaggaaag aacaagaagg ggcgcggtcg
     2941 caaaaataat tacaacgcct tctcgagacg tggcttgagt gatgaggagt atgaggagta
     3001 taagaaagtt agagaggaga agggtggtaa ttacagtatc caggagtacc tagaagaccg
     3061 gcagcgctat gaagaggagt tggcagaggt gcaggccggt ggtgatggcg ggatgggtga
     3121 aacagaagct gagatccgct accgggtatt ctacaagtcc aaaagtggga tgcgaaagca
     3181 acgccaggag gagcgccgac aacttgggct ggtttcaggc actgaaatca gaaaacgcaa
     3241 acccatagat tggacccccc ctaaaaatga ttggtcagaa gacaccagag aagtcaatta
     3301 tgatgaacac ataagctttg aagccccgcc ctctatatgg agcagggtag taaaatttgg
     3361 tagtggatgg ggcttctggg ttagcccaac tgtgttcatc acaaccacac atgttatacc
     3421 accagaagca aaggaaatat ttggagagaa agtctctgac atagcaatac atagggtcgg
     3481 agagttcacc cagtttaggt tctcaaagaa aatgaggcca gatctcagtg gcatggtact
     3541 ggaagagggg tgtcctgagg gcacggtttg caccatcatg ataaaaaggg actcaggtga
     3601 gctgttgccc ttggcagttc gcatgggtgc tgtggcatcc atgaaaatac agggtaagct
     3661 catgcatggc cagtctggta tgttgctgac aggggcaaat gcaaaaggaa tggatctagg
     3721 taccatccct ggtgattgtg gggccccgta cgtgcacaag agggggaatg actgggttgt
     3781 gtgtggcgtg catgcagccg caactaaatc aggaaacaca gttgtctgtg ccatacagtc
     3841 aggtgagggg gaagccaccc tcgaaggagg tggacagaat aaagggcact acgcaggcca
     3901 tccaattctc agatatggta atggcccttc cctctccacc aagacaaagt tctggaaatc
     3961 aaccccacaa cccctcccgc ctggaaccta tgagccagct tatctcgggg gacgtgatcc
     4021 cagagtcgaa ggtgggccat cactccaaca ggtcttacga gatcagctta aacccttcgc
     4081 tgaacctcga ggtagattac cagaaccaag cctacttgaa gcggctgtgg aaacagtcac
     4141 gaatgtgcta gaacagacta tggacactcc aataccgtgg agctacagtg atgcatgcat
     4201 gtcccttgat aagaccacca gttctgggtt cccacaccac aaaaagaaaa atgatgactg
     4261 gaatggcagc acatttgtgc gggagcttgg tgatcaggca gcacacgcca ataacatgta
     4321 tgaaatgggg aagtccatga agccagtgta tactgctgca ctgaaggatg agctagtgaa
     4381 gcctgagaaa gtgtatacaa aggttaaaaa gaggctactt tggggtgcag atctcggcac
     4441 ggtcattcgc gctgctcgag cgtttggccc tttttgtgag gccataaaac cacatgttat
     4501 aaaattgccc attaaggttg gcatgaatgc aattgaagat ggccccatga tatatgctga
     4561 gcatgccaag tacaagtacc attttgatgc tgactacaca gcatgggact ccacccagaa
     4621 tagagaaatc atgttagaat ccttcaacat catgtgcaaa ttaacggcta acccatcact
     4681 cgctgccgtc gtggcacagg atttattgtc cccatcagaa atggacgttg gagactatgt
     4741 gattagtgtc aaggatggtc taccttcagg gttcccgtgc acctcgcaag tgaacagcat
     4801 aaaccactgg atctacaccc tatgtgccct ttcagaggta acaggtctgg cacctgatgt
     4861 tctgcagtct caatcatatt tctcttttta tggagatgat gaaattgtgt caactgatgt
     4921 ggaatttgac cctgtgaaac tcacccaggt acttaaagag tatggtttaa aacccacccg
     4981 ccctgacaaa tcagaaggac ccatcatagt gaagcaatgt gtggatggtc tagttttcct
     5041 aaggcgcact atatcgaggg atgctgcagg gtaccaaggg cgactggatc gcaactccat
     5101 agaaagacaa ctttggtgga cccggggccc aaatcatgat gacccatttg aaactttggt
     5161 gcctcatcag caaagaaaga tacaactgat ttccttgctt ggggaggctg cacttcacgg
     5221 agaaaaattc tacagaaaga ttgccaacag agtgattcag gaagtcaaag aggggggcct
     5281 tgagctttat gtgcccggct ggcagcccat gttccgctgg atgcggttcc atgatctgag
     5341 cttgtgggca ggagatcgca atctcctccc cgattatgta aatgatgatg gcgtctaagg
     5401 acgctacctc aaacatggat ggcaccagcg gagctggaca actggtgcca gagaataata
     5461 acacctcaga accaatcaac atggaaccag tcgcgggcgc ggtcactgcc gcagctacgg
     5521 ctggccaggt gaatatgatt gatccttgga taatgaataa ttatgtacaa gccccccagg
     5581 gcgagttcac aatttcgccc aataatactc ctggtgatat attgtttgat cttcaattag
     5641 gtccccatct aaaccccttt cttgcccatt tatcccaaat gtataatgga tgggttggta
     5701 acatgaaagt cagggtggtg ttggctggca atgccttttc tgcgggaaag atcatagtgt
     5761 gctgtatacc acctggattc tctgcaccaa acatatccat agcccaggca actatgttcc
     5821 ctcatgttat tgctgatgtt cgggtcttgg agcccattga tattcccctt gatgatgtca
     5881 ggaatgttct gtttcataat aatgataatg gtaatcagac tatgagattg ctgtgcatgt
     5941 tgtatacacc actccgtagt ggaggcacgt ccagtggaac tgacccgttt gtgattgctg
     6001 gtagggttct aacctgccct actccagatt ttaatttctt gttcttggtt cccccaaccg
     6061 ttgagcaaaa gaccaaacag tttagtgtgc ctaaccttcc cctcaatgtt atgtctaatt
     6121 ctagagttcc atcactccta aatgctatgg tggtgtcacc agatcaggcc caagtggtgc
     6181 aatttcaaaa tggcaggtgc acccttgatg ggcaaatgtt gggcaccacc actgtatcag
     6241 ctagctgtgt tgcaagattc agagggaaaa cttttcaagc ccctgacaac aggttaggta
     6301 tcaatctggc tgaaattagt ggagaaccat accatgcatt tgaaagccct gcccccctag
     6361 gtttccctga ctttggggat ggagattggc acgtcactgc aacaaaagtg accccctcac
     6421 agcttgaggc taatgaccct gtggtcatgg ggaatgtcca accatataac ccacagtttg
     6481 ctcctcacct gggcacccta gtcgtagaaa accctactcc agacaatgtg accaccggga
     6541 ctgacttatt gttcaacata acctggcttt ccaatcgtgc caataatcgg tttaaccctt
     6601 gggttatccc aaattatggt tcaactctta ctgaggcagc acagctggca ccttcaatat
     6661 ttccccctgg ttttggtgaa actatagtgt atttcaattc cacttttcca gctgtggggg
     6721 ccaccaccca tgcagctata ccctgtctgc ttccacaaga atttgttgcc cattttgtta
     6781 atgaacaggc ccccatacgt ggagaggctg ctttgctcca ctacattgac cctgatactc
     6841 accgtaatct tggtgagttc aaaatttatc cagagggctt tgtaacgtgt gttcctaatg
     6901 tgggtggtac ggggccacaa tctctaccta ctaatggtat ctttgtcttt gtctcttggg
     6961 tgtcaaggta ctatcaactc aagcctgtgg gaactgctgg tcaagcaagg cggcttggtt
     7021 tcaggagagt ataatggctc aagcaatatt cggagccatt gcagctacag ctgcgggtag
     7081 tgctgtcagt gctagcattg acgccggcac acaggctgca ctacaatacc agcgttatca
     7141 acaggatctt gatctccaat ctaaatcttt cctccatgat gagcgtatgc ttggtttgca
     7201 agtagatgct agtaatgctt tgttgcaaaa gaatctatct actaggtata atctattgct
     7261 ttcttctggt atgtcctcct ctgatgctgc tcgcatgatt gctggcgcac caccaacaaa
     7321 aatagttgat tggaatggag tccgggtggc agccccaagg tcctcagcta caactttacg
     7381 ttctgggggc tttatgccgg ttgcttcact gtccacgact ccaaaaatga agaatgatgg
     7441 tgcaggtata gtaaacccca attatgcacc tagccacagt tcaatggtct ctcgaaccac
     7501 acaatgggtc gagagccaga actccctgag aagtctagaa ccattccacc acggagcctt
     7561 gcagaccgca tgggtgaccc caccaggttc ttcttctacc tccacagtgt ctagtgtgtc
     7621 aactgcacca agatatttta atactgaaag acttcctcta ttcgcaaatt tgaggaaatg
     7681 a
//