Typing tool

Complete norovirus genomes

KX907730  GI.7
 GI.P7

Length: 7,647 | 3 CDS

ORF1: 4..5400
ORF2: 5384..7000
ORF3: 7000..7647
LOCUS       KX907730                7647 bp    RNA     linear   VRL 07-NOV-2016
DEFINITION  Norovirus Hu/USA/2014/GI.P7_GI.7/GA5043, partial genome.
ACCESSION   KX907730
VERSION     KX907730.1
KEYWORDS    .
SOURCE      Norovirus Hu/USA/2014/GI.P7_GI.7/GA5043
  ORGANISM  Norovirus Hu/USA/2014/GI.P7_GI.7/GA5043
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7647)
  AUTHORS   Collins,N., Aswath,K., Barclay,L. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-SEP-2016) NCIRD/DVD/GRVLB, CDC, 1600 Clifton Rd NE,
            Atlanta, GA 30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7647
                     /organism="Norovirus Hu/USA/2014/GI.P7_GI.7/GA5043"
                     /mol_type="genomic RNA"
                     /strain="Hu/USA/2014/GI.P7_GI.7/GA5043"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1914544"
                     /country="USA"
                     /collection_date="06-Feb-2014"
                     /note="genotype: GI"
     CDS             4..5400
                     /note="ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="APA31978.1"
                     /translation="MMMASNDAVAAADVSKQNANTNNENIGSRLMAKLKERISSQRGE
                     GTTKIKNTEMALDLIRRSQTPSPTRSDPPPKAQRDRPPRTVSEVKQALGWNGPASKDY
                     GARAWCDLTAEEKKEILDNNERLFDAGGVTPSTVPSTFERCETSERVDGCHPVKWSES
                     AGVDLGVDSLTTVTGPVWNMCPLPPIDSRNNGPASEPRIGDMIEFYEGHIFHYAIYLG
                     QGKTIGVHSPQAAFSIARITIHPMAAWWRVCYEPTDQQRLSYDQLKELENEPWPYASI
                     TNNCYEFCCRVMSLDDTWLQRKLVTSGRFNHPTQEWSKETPDFHQDSKLEIVRDAILS
                     AINGLVSQPFKNILSKIKPLNLLSLLSNCDWTFMGVVELVVLLAELFDIFWTPPDISN
                     FIASLLPDFHLQGPEDLARDLVPLILGGIGLAIGFTRDKITKVMKSAVDGLRSATQLG
                     QYGLEVFSIIKKYFFGGDQTEKTLKGIENAVIDMEVLSSTNVTQLVRDKKLAKTYMNI
                     LDNEEEKARKLSVRSADPHVVTTVNNLISRISMARSALAKAQAEMTNRARPVVIMMCG
                     PPGIGKTKAAEHLANRLASEIRPGGKVGLVPRESIDHWDGYHGEEVLLWDDYGMSKIT
                     EDCNKLQAIADTAPLTLNCDRIENKGMQFVSDAIIITTNAPGPAPVDFVNLGPVCRRV
                     DFLVYCTAPEIEQTRRAHPGDTNAIKNLFKPDFSHLKMEIAPQGGFDNQGNTPFGKGA
                     MKSTTLNRLLIQAVALTMERQDEFQMQGVVYNFDEDRVTAFTSLARVNGLGLLSMAAL
                     GKKLRSVNNMEGLRNALKGYKITECDIVWNNRTYTIKGDGSNVSVTEKQAAATLQQQA
                     ISSVTLALSRLRAARALAYASCLQSAVTTILQMAGSAVVISRAVKRMFGTHTNQPALE
                     GKPREHNCRAHRAEREGRGPIGHDGIIERYGLCETDQEEEEKIEMEVPTADKEGKNKG
                     KNKKGRGRKNNYNAFSRRGLSDEEYEEYKKVREEKGGNYSIQEYLEDRQRYEEELAEV
                     QAGGDGGIGETEAEIRHRVFYKSKSGMRKQRQEERRQLGLVTGTEIRKRKPIDWTPPK
                     NDWSEDTRQVNYDEHISFEAPPSIWSRVVKFGSGWGFWVSSTVFITTTHVIPPEAKEI
                     FGEKLSDIAIHRVGEFTQFRFSKKMRPDLSGMVLEEGCPEGTVCTIMVKRDSGELLPL
                     AVRMGAVASMKIQGKLMHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCG
                     VHAAATKSGNTVVCAIQSGEGEATLEGGGQNKGHYAGHPILRYGNGPSLSTKTKFWKS
                     TPQPLPPGTYEPAYLGGRDPRVDGGPSLQQVLRDQLKPFAEPRGRLPEPSLLEAAVET
                     VTNVLEQTMDTPVPWSYSDACMSLDKTTSSGYPHHKRKNEDWNGNAFVRELGEQAAHA
                     NNMYELGKSVKPVYTAALKDELVKPEKVYTKIKKRLLWGADLGTVIRAARAFGPFCEA
                     IKPHVIKLPIKVGMNAIEDGPLIYAEHAKYKYHFDADYTAWDSTQNREIMLESFNIMC
                     KLTANPSLAAVVAQDLLSPSEMDVGDYVISVKDGLPSGFPCTSQVNSINHWIYTLCAL
                     SEVTGLAPDVLQSQSYFSFYGDDEIVSTDVEFDPIKLTQVLREYGLKPTRPDKSEGPI
                     IVKQQIDGLVFLRRTISKDAAGYQGRLDRNSIERQLWWTRGPNHDDPFETLIPHQQRK
                     IQLISLLGEAALHGEKFYRKIANRVIQEVKEGGLELYIPGWQAMFRWMRFHDLSMWTG
                     DRNLLPDYVNDDGV"
     CDS             5384..7000
                     /note="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="APA31979.1"
                     /translation="MMMASKDAPSNMDGTSGAGQLVPEVNAAEPLPLEPVVGAATAVA
                     TAGQVNMIDPWIMNNFVQAPEGEFTISPNNTPGDILFDLRLGPHLNPFLLHLSQMYNG
                     WVGNMRVRVMLAGNAFSAGKIIICCVPPGFESQNISIGQATMFPHVIADVRVLEPIEV
                     PLDDVRNVLFHTNENRPTMRLLCMLYTPLRAGGASSGTDPFVIAGRVLTCPAPDFNFL
                     FLVPPSVEQKTRQLTIPNIPLNNLANSRVPAMINKMTVSADQNQVVQFQNGRCTLEGQ
                     LLGTTPVSANQVARIRGKVFSTNSGTGLNLTEVDGTPYHAFESPAPLGFPDIGNCDWH
                     VYAFKVNQNTGDPMYRLDITQGNSFAPHLGSIEFSSENHPSGDQLGTLTWISPLNNAS
                     RVDPWKIPTYGSTLTESTNLAPPIFPPGFGEAIVYFMSDFPIVSGNTAQIPCTLPQEF
                     VSSFVEQQAPIRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPSNGV
                     FVFSSWVSRYYQLKPVGTTGPVRRLGVRRV"
     CDS             7000..7647
                     /note="ORF3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="APA31980.1"
                     /translation="MAQAIIGAIAATAAGSAVGAGIQAGTEAALQYQRFQQDLTLQEN
                     SFKHDERMLGLQIEGSNALLQKNLSTRYNLLVGAGLSSADAARSIAGAPVTKIVDWNG
                     VRIAAPTSTATTLRSGNFMSIPTIPKKEPQKLSARSVGLSNPNYDSSTMISRTSQWVE
                     SQNSIRNLSPFHSSALRTTWVTPPGSTSTSTFSTVSSAPRYFNTERLPLFANNRK"
ORIGIN      
        1 tgaatgatga tggcgtctaa cgacgctgtt gccgctgctg atgtcagcaa acaaaatgct
       61 aacactaaca acgaaaacat cggttctcgc cttatggcga aactgaaaga gcgtataagc
      121 tctcaacgtg gtgaaggaac cacgaaaatc aagaacactg aaatggcact ggatctgata
      181 cgtaggtccc aaacaccatc gccaacgcgc tcggaccccc ctcctaaggc acaacgcgac
      241 cgccctccga ggactgtgtc agaagtcaag caagctttag gttggaatgg ccccgctagt
      301 aaggattatg gggcccgagc atggtgtgac ttaacagctg aagaaaagaa ggagatcttg
      361 gacaacaacg agcgcctctt tgacgctggc ggtgtgaccc cttcgacagt accgagcacc
      421 tttgagagat gtgaaacatc tgaacgagtc gacggctgcc accctgtcaa atggagcgag
      481 tctgcgggag tggatttagg cgtggattct ctgaccactg ttacaggtcc agtatggaat
      541 atgtgccccc ttccaccgat tgattcacgt aacaatggcc ctgcaagtga gccacgcatt
      601 ggagacatga tagaatttta tgaagggcat atatttcatt atgccatata tcttggtcag
      661 gggaagacca taggagtcca ctccccccag gcagctttct ccatagctcg tataactata
      721 caccctatgg cagcatggtg gcgtgtctgt tatgaaccaa cagatcaaca acgcctcagc
      781 tatgaccaat taaaggaact tgagaatgaa ccgtggccct atgcatccat aacgaataat
      841 tgttatgagt tctgctgccg tgtcatgtct ctagacgaca cctggttaca acgaaagctg
      901 gtgacgtccg gtaggtttaa tcaccccacc caggagtggt ccaaggaaac acctgatttc
      961 catcaagatt caaaattgga aatagtgaga gacgcaatac tgtccgccat aaatggcttg
     1021 gtctctcaac cctttaagaa tatcctctca aaaattaagc cactgaattt gctgtctttg
     1081 ctatcaaatt gtgattggac tttcatgggg gtcgtcgagc tagtggtgct actggctgaa
     1141 ttgtttgaca tcttctggac cccacctgac atctccaact tcatagcatc tctcctacca
     1201 gactttcacc tgcaagggcc agaggatttg gcaagagacc tggtcccatt aatattgggg
     1261 ggtattggcc tggctattgg tttcactaga gacaaaatca caaaggtcat gaagagtgcc
     1321 gttgacggtt tgcgctctgc cacgcagctt ggacaatatg gccttgaggt gttctcgatc
     1381 ataaagaagt atttctttgg tggagaccaa actgagaaaa ctctcaaggg catagagaat
     1441 gcagtcatag atatggaggt cctgtcaagt accaatgtca cacaactggt gcgcgacaag
     1501 aagttggcca aaacatacat gaatatcctg gacaatgagg aggaaaaggc aagaaaactc
     1561 tcagtgcgca gtgcagaccc acatgttgtg acaacagtca acaatctcat ctcgcgcata
     1621 tccatggcgc ggtcagctct tgccaaggct caggctgaga tgactaatcg ggcacgcccc
     1681 gtggtcataa tgatgtgtgg gccaccaggt ataggaaaaa ccaaagctgc tgaacacctg
     1741 gctaatcgcc tggctagtga gataagacca gggggaaaag tgggtttagt gcctagagaa
     1801 tccattgacc actgggatgg ctaccatggg gaagaagtcc tgctgtggga tgactacggc
     1861 atgtccaaga taacagagga ttgtaataaa ctacaggcca tagctgatac tgccccactc
     1921 acactcaact gtgacagaat agaaaacaag ggtatgcagt ttgtgtcaga tgcaataata
     1981 ataacaacca atgcccccgg gccagccccc gtcgactttg ttaatcttgg tccagtatgt
     2041 cgacgtgtag acttcttggt gtactgcacc gcccccgaaa ttgaacagac cagaagagcc
     2101 caccctgggg acaccaatgc tattaagaat ttgttcaaac cagacttttc ccatctgaaa
     2161 atggagatag caccacaagg gggatttgac aatcaaggta acaccccttt tgggaagggt
     2221 gccatgaaat caaccacact caataggcta ctcatacagg cagttgcctt gacaatggaa
     2281 agacaagatg agttccagat gcagggggtg gtgtataact ttgatgagga ccgggttaca
     2341 gctttcacta gcctggcccg ggtcaacgga ctaggacttc tgagcatggc tgcactcggt
     2401 aaaaagttgc ggagcgtcaa taatatggaa ggactccgca acgccctcaa agggtacaag
     2461 atcactgagt gtgatattgt gtggaacaac aggacttaca ccattaaggg agatggatca
     2521 aatgtgagcg tcacagaaaa gcaggcagct gccactcttc agcaacaagc catcagctca
     2581 gtcactttgg cactttctag gttgcgcgcc gcacgagcgt tggcgtatgc atcatgtctc
     2641 cagagcgcag taaccaccat cttgcaaatg gctgggtctg cagtggtgat cagcagggca
     2701 gtcaaacgca tgtttgggac ccacaccaat cagccagcac tggagggcaa acccagggaa
     2761 cacaactgca gggcccaccg tgccgaaagg gaaggtcgtg gccctattgg ccatgatggc
     2821 atcatagagc ggtacggtct gtgtgagact gatcaagaag aagaagaaaa gatcgagatg
     2881 gaagtgccaa ctgcagacaa agaaggcaag aataaaggca agaacaagaa ggggcgaggt
     2941 aggaaaaaca actacaacgc tttctctagg cgaggcctaa gtgatgagga gtatgaagaa
     3001 tacaagaagg tcagagaaga gaagggtggt aactacagca tccaagaata cctcgaggac
     3061 cgccaacgat atgaagaaga gttggctgag gtccaagcag gtggagatgg cgggatcggt
     3121 gaaacagagg cagagatccg ccatcgtgtt ttctacaaat ccaagagtgg catgcgaaaa
     3181 caacgtcaag aggagcgccg acagcttgga ttagtcacag gcactgaaat cagaaagcgc
     3241 aagcccatag attggacacc acctaagaat gactggtcag aagacactag acaggtcaac
     3301 tatgatgagc acatcagctt tgaagcccca ccttctattt ggagtagagt ggtcaaattt
     3361 ggcagtggat ggggcttttg ggtgagttca acagttttta ttacaaccac acacgtcata
     3421 ccaccagaag ccaaagaaat ttttggggaa aaactttcag acatagcaat acacagagtt
     3481 ggagagttca cacaatttag attctctaag aaaatgagac ctgacctcag tggtatggtc
     3541 cttgaggagg ggtgcccgga gggaacggtg tgcactataa tggtgaagag agactcaggc
     3601 gaactgctac ctctagcagt gcgcatggga gctgttgcgt ccatgaagat acaaggtaag
     3661 ctcatgcatg gtcagtctgg tatgttgcta accggtgcaa atgctaaggg aatggacctg
     3721 ggcaccatcc ctggtgactg tggagctcca tatgtgcata agaggggaaa tgactgggtg
     3781 gtgtgtggag tgcacgcagc agcaaccaag tcaggcaaca ccgtggtgtg tgcaatacaa
     3841 tcaggtgaag gtgaagctac ccttgaaggg ggcggacaaa acaaagggca ttatgcaggc
     3901 cacccaattt taagatatgg caatgggccc tctctctcta caaaaactaa attctggaaa
     3961 tcaacccccc aaccactccc gcctggaacc tatgaaccag cttacctagg tggacgtgac
     4021 cccagggtag acggtggtcc atctctccaa caagtcctac gtgaccaact caaacctttt
     4081 gctgagcccc gtggcagact gccagaaccg agcttgctcg aagcagctgt ggagactgtt
     4141 acaaatgttt tagaacaaac catggacaca cctgtacctt ggagttatag tgacgcttgt
     4201 atgtctcttg acaagaccac cagctcaggt tatccgcacc ataaacgcaa gaatgaagat
     4261 tggaatggca atgcgtttgt gcgtgaactt ggggaacagg cagctcatgc taataacatg
     4321 tatgaattgg gcaagtcagt taaaccagtt tacacagcag cacttaaaga tgaattggta
     4381 aaacctgaaa aagtgtacac aaaaataaaa aagagactgc tttggggagc ggaccttggc
     4441 acagtcattc gggctgcccg agccttcggc ccattttgtg aggcgataaa gccacatgtg
     4501 ataaaattgc cgatcaaggt tggcatgaat gcaattgaag atggccccct catatatgct
     4561 gaacatgcaa agtataaata tcattttgat gcagattaca cagcttggga ctcaactcag
     4621 aatagagaaa tcatgctaga atctttcaat atcatgtgta agcttacagc caatccatca
     4681 ctggccgctg ttgtggcaca ggacctactg tccccatcag aaatggatgt gggggattat
     4741 gtgattagtg ttaaggatgg cctcccctca gggttcccat gcacctcgca agtgaacagc
     4801 ataaaccatt ggatttacac tctgtgcgcc ctgtcagagg tcactggcct ggcacctgat
     4861 gttttgcaat cccagtctta cttctccttc tacggggatg atgagatagt gtcaactgat
     4921 gtggaatttg acccaataaa actcacccaa gtgctcagag agtatggttt gaagcccacc
     4981 cgacctgaca aatcagaagg acccatcata gtgaaacaac agatagatgg gctggtcttc
     5041 ctcaggcgca ctatatcaaa agacgctgct ggttaccagg ggcgtttaga ccgcaactcc
     5101 attgaaaggc aattgtggtg gactcgggga ccaaatcatg atgacccctt cgaaactctg
     5161 ataccccatc aacaaaggaa aattcaattg atatccctgc ttggtgaggc tgcactccat
     5221 ggagagaaat tttacaggaa gattgctaat agggtgatac aagaagttaa ggagggaggg
     5281 cttgaactct acataccagg ttggcaggcc atgtttcgct ggatgcgatt ccatgacttg
     5341 agcatgtgga caggagatcg caatctactg cccgattatg taaatgatga tggcgtctaa
     5401 ggacgccccc tcaaacatgg atggcaccag tggtgccggt cagctggttc cagaggttaa
     5461 tgcagctgaa cctctacccc ttgaaccggt ggtgggcgcc gcaactgcgg tggccaccgc
     5521 tggacaggtt aatatgatag acccctggat tatgaataat tttgtccaag cccctgaagg
     5581 cgaatttact atttcaccca acaacacccc tggagatatt ttatttgatt tgcgtctggg
     5641 accacacctt aacccctttc tcctgcattt gtcccagatg tataatggat gggttgggaa
     5701 tatgagagtt agggtcatgc ttgcagggaa cgcgttctct gctggtaaga tcataatttg
     5761 ttgtgtccca cctggctttg aatcccagaa catatcaatt ggacaagcca caatgtttcc
     5821 ccatgtcatt gctgatgtga gagtcctgga gcccatagag gtcccccttg atgatgtgcg
     5881 caatgtcctg ttccacacaa atgagaaccg cccaaccatg cgactgctct gtatgttgta
     5941 cacacctctc cgtgctggag gagcttcatc aggcacagac ccttttgtca ttgctggccg
     6001 tgtgttaact tgccctgctc ctgatttcaa ttttctgttt cttgtgcccc ctagtgtaga
     6061 acaaaagacc aggcaattga ctatacccaa tatacccttg aacaatttgg ctaactccag
     6121 agtgcctgca atgataaaca agatgacagt ctctgctgat cagaatcagg tggtccagtt
     6181 tcaaaatggc cgttgcacac ttgaagggca actcttaggc acaacccctg tttcagccaa
     6241 tcaagttgcc cgtatacgtg gcaaagtctt ttccaccaac tccgggacgg ggcttaattt
     6301 aactgaagta gatggaaccc cctaccatgc atttgagagc ccggcccctc tcggttttcc
     6361 tgacattggt aattgtgatt ggcacgtgta tgcctttaag gtaaatcaaa acacagggga
     6421 ccccatgtac aggctggaca taacacaagg aaactcattt gcgccgcatc ttggctccat
     6481 tgagtttagt tctgaaaacc acccatcggg ggaccaacta ggcacactta cttggatctc
     6541 ccctcttaac aatgcttcta gggttgatcc ctggaaaatc ccaacatatg ggtcgacatt
     6601 gactgagtcc accaacttgg caccacccat ctttccacca ggttttggtg aggctatagt
     6661 ttattttatg tcagattttc ctattgtgtc aggtaatact gcccaaatcc cctgcaccct
     6721 gccccaagaa tttgtttcat cctttgtgga gcagcaggca ccgatccgag gtgaagctgc
     6781 tctattgcat tatgtggacc cagataccca tcgcaatctg ggagaattca aattgtaccc
     6841 tgatgggttc atcacttgtg tgcctaacac gggtggcggc ccccaaaatc tcccatcgaa
     6901 tggtgtcttt gttttctctt cttgggtttc tagatattat caattaaagc ctgtgggaac
     6961 aaccggtccg gttaggaggc ttggtgtgag aagggtataa tggcccaagc catcatagga
     7021 gctattgccg ccaccgctgc tggcagcgca gtgggggcag gtatccaagc tggaactgag
     7081 gcagccttgc aataccaaag gtttcaacag gatctcacac tgcaggagaa ttcttttaag
     7141 catgatgaaa ggatgttggg tttacaaatt gaggggtcta atgctttgct acaaaagaat
     7201 ctttctaccc gctataatct cttagttggt gcaggtcttt cctcagctga tgccgcaagg
     7261 tctatagctg gggctccagt gacaaaaatc gtggactgga atggggtaag aatcgctgcc
     7321 cccacgtcca ctgccaccac cctccgttct ggcaatttta tgagcatacc aaccataccc
     7381 aaaaaggagc cccaaaaact gtcagcacgt tctgtaggtc tttccaatcc taattatgat
     7441 tcatccacta tgatttctag gacaagtcaa tgggtggagt cgcaaaattc aattaggaat
     7501 ttgtcacctt tccatagttc ggccctgagg actacttggg taacccctcc tggttctact
     7561 tctacttcaa ctttttctac tgtctcttcg gcgccacggt acttcaacac cgagcgtctt
     7621 cctttgttcg caaacaatag gaaatag
//