Typing tool

Complete norovirus genomes

KX907729  GI.7
 GI.P7

Length: 7,648 | 3 CDS

ORF1: 5..5398
ORF2: 5382..7001
ORF3: 7001..7648
LOCUS       KX907729                7648 bp    RNA     linear   VRL 07-NOV-2016
DEFINITION  Norovirus Hu/USA/2011/GI.P7_GI.7/CS5567, partial genome.
ACCESSION   KX907729
VERSION     KX907729.1
KEYWORDS    .
SOURCE      Norovirus Hu/USA/2011/GI.P7_GI.7/CS5567
  ORGANISM  Norovirus Hu/USA/2011/GI.P7_GI.7/CS5567
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7648)
  AUTHORS   Collins,N., Aswath,K., Barclay,L. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-SEP-2016) NCIRD/DVD/GRVLB, CDC, 1600 Clifton Rd NE,
            Atlanta, GA 30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7648
                     /organism="Norovirus Hu/USA/2011/GI.P7_GI.7/CS5567"
                     /mol_type="genomic RNA"
                     /strain="Hu/USA/2011/GI.P7_GI.7/CS5567"
                     /host="Homo sapiens"
                     /db_xref="taxon:1914543"
                     /country="USA"
                     /collection_date="27-Jun-2011"
                     /note="genotype: GI"
     CDS             5..5398
                     /note="ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="APA31975.1"
                     /translation="MMMASNDAITAADVSKQNANTNNENIGSRLMAKLKERISSQRGE
                     GTTKIKNTEMALELIRRSQTPSPTRPDPPPKSQRDRPPRTVSEVKQALGWGDSAHKDY
                     GARAWCDLTAEEKKEILDNNERLFDAGGVTPSTVPSTFERCETLEQTNDNHPVRWNES
                     TGVNLGVGPLTTVAGPVWNMCPLPPIDSRNNGPANEPRIGDMIEFYEGHIFHYAIYLG
                     QGKTIGVHAPRAAFSIARITIHPITAWWRICYEPTDHQRLSYDQLKELENEPWPYASI
                     TNNCYEFCCRVMSLDDSWLQRKLVTSGRFNHPTQEWSRDTPDFHQDSKLEIVRDAILS
                     AINGLVSQPFKNILSKIKPLNLLSLLSNCDWTFMGVVELVVLIAELFDIFWTPPDVSN
                     FIASLLPDFHLQGPEDLAKDLVPLILGGIGLAIGFTRDKITKVMKSAVDGLRSATQLG
                     QYGLEIFSIIKKYFFGGDQTEKTLKGIENAVIDMEVLSSTNVTQLVRDKKLAKTYMNI
                     LDNEEEKARKLSVRSADPHVVTTVNNLISRISMARSALAKAQAEMTSRARPVVIMMCG
                     PPGIGKTKAAEHLANRLAGEIRPGGKVGLVPRESIDHWDGYHGEEVLLWDDYGMSKIT
                     EDCNKLQAIADTAPFTLNCDRIENKGMQFVSDAIIITTNAPGPAPVDFVNLGPVCRRV
                     DFLVYCTAPEIEQTRRTHPGDTNAIKDLFKPDFSHLKMEIAPQGGFDNQGNTPFGRGA
                     MKPTTLNRLLIQAVALTMERQDEFQMQGAVYNFDEDRVTAFTSLARANGLGLLSMAAL
                     GKRLRSVNNMEGLRNALKGYKITECDIVWNNRTYTIKGDGSNVSITEKQVAASLQQQA
                     VSSVTLALSRLRAARALAYASCFQSAVVTILQMAGSAVVISRAVKRMFGTHTNQPALE
                     GKPKEHNCRVHRAEREGHGPIGHDGIIERYGLCESDQDEEKIVMEVPTADKEGKNKGK
                     NKKGRGRKNNYNAFSRRGLSDEEYEEYKKVREEKGGNYSIQEYLEDRQRYEEELAEVQ
                     AGGDGGIGETEAEIRHRVFYKSKSGMRKQRQEERRQLGLVTGAEIRKRKPIDWTPPKN
                     DWSEDTREVNYDEHISFEAPPSIWSRVVKFGSGWGFWVSSTVFITTTHVIPPDAKEVF
                     GEKLSDIAIHRVGEFTQFRFSKKMRPDLSGMVLEEGCPEGTVCTIMVKRDSGELLPLA
                     VRMGAVASMKIQGKLMHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGV
                     HAAATKSGNTVVCAIQSGEGEATLEGGGQNKGHYAGHPILRYGNGPSLSTKTKFWKST
                     PQPLPPGTYEPAYLGGRDPRVDGGPSLQQVLRDQLKPFAEPRGRMPEPSLLEAAVETV
                     TNVLEQTMDTPVPWSYSDACMSLDKTTSSGFPHHKRKNDDWNGSAFVRELGEQAAHAN
                     NMYELGKSVKPVYTAALKDELVKPEKVYTKIKKRLLWGADLGTVIRAARAFGPFCEAI
                     KPHVIKLPIKVGMNAIEDGPLIYAEHAKYKYHFDADYTAWDSTQNREIMLESFNIMCK
                     LTADPSLAAIVAQDLLSPSEMDVGDYVISVKDGLPSGFPCTSQVNSINHWIYTLCALS
                     EVTGLAPDVLQSQSYFSFYGDDEIVSTDVEFDPTKLTQVLREYGLKPTRPDKSEGPII
                     VKHQIDGLVFLRRTISKDAAGYQGRLDRNSIERQLWWTRGPNHDDPFETLIPHQQRKI
                     QLISLLGEAALHGEKFYRKIANRVIQEVKEGGLELYIPGWQAIFRWMRFHDLSLWTGD
                     RNLLPDYVNDDGV"
     CDS             5382..7001
                     /note="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="APA31976.1"
                     /translation="MMMASKDAPSNMDGTSGAGQLVPEVNAAEPLPLEPVVGAATAVA
                     TAGQVNLIDPWIMNNFVQAPEGEFTISPNNTPGDILFDLQLGPHLNPFLQHLSQMYNG
                     WVGNMRVRVMLAGNAFTAGKIIICCVPPGFASQNISIGQATMFPHVIADVRVLEPIEI
                     PLDDVRNVLFHTNESRPTMRLLCMLYTPLRAGGASSGTDPFVIAGRVLTCPSPDFNFL
                     FLVPPSVEQKTRQLTVPNIPLNNLANSRVPAMINKMTVSTDQSQVVQFQNGRCTLEGQ
                     LLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHAFESPAPLGFPDIGACDWH
                     VSTFKVDQNLSGDPMSRLDIKQNAPFAPHLGSIEFTSDQEPTGDQLGTLAWVSPSTSG
                     ARVDPWKIPSYGSTVTESTHLAPPIFPPGFGEAIVYFMSDFPIVSGNTAQVPCTLPQE
                     FVSHFVEQQAPIRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPING
                     VFVFSSWVSRYYQLKPVGTAGPARRLGVRRV"
     CDS             7001..7648
                     /note="ORF3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="APA31977.1"
                     /translation="MAQAIIGAIAATAAGSAVGAGIQAGTEAALQYQRFQQDLTLQEN
                     SFKHDERMLGLQIEGSNALLQKNLSTRYNLLVGAGLSSADAARSIVGAPVTKIVDWNG
                     VRIAAPTSTATTLRSGNFMSIPVTPRKESQNLSARSVGLTNPNYDSSTMISRTTQWVE
                     SQNSARNLSPFHSSALRTTWVTPPGSTSTSTFSTVSSVPRFFNTERLPLFANNRK"
ORIGIN      
        1 gtgaatgatg atggcgtcta acgacgctat taccgctgct gatgtcagca aacaaaatgc
       61 taacaccaac aacgaaaata tcggttctcg cctcatggcg aaactgaagg agcgtataag
      121 ctcccaacgt ggtgaaggca ccacaaagat taaaaacact gaaatggcat tggaattaat
      181 acgtaggtcc caaacaccat ccccaacacg cccagatccc cctcctaaat cgcagcgtga
      241 tcgccctcca agaactgtat cagaagttaa acaagcttta ggttggggtg attccgccca
      301 taaggattat ggggcccgag cgtggtgtga cctaacagct gaggaaaaga aagagatctt
      361 ggacaacaat gagcgcctct ttgatgctgg cggtgtgact ccatcaacag taccaagcac
      421 ttttgagagg tgtgagacac ttgaacaaac caatgataac catcctgtta gatggaatga
      481 gtccacggga gtgaatctag gtgttggccc tctaaccaca gttgcaggtc cagtgtggaa
      541 tatgtgtcct cttccaccga ttgactcgcg caataatggc cctgcaaatg aaccacgtat
      601 tggggatatg atagagtttt atgaagggca catatttcac tatgccatat accttggcca
      661 agggaagacc ataggggtcc acgccccccg agcagccttc tccatagcac gcatcaccat
      721 acaccctatc acagcatggt ggcgtatctg ctatgagccc acagaccatc aacgcctcag
      781 ctatgaccaa ttgaaagagc ttgagaatga gccatggcct tatgcatcca taacaaacaa
      841 ttgttatgag ttctgttgcc gcgtcatgtc cctggacgac tcctggttgc agcgaaaact
      901 agtgacctct ggcaggttta accaccctac tcaggaatgg tctagggaca caccggactt
      961 ccatcaagat tcgaaattag aaatagtgag agatgcaatt ctatctgcta taaatggcct
     1021 agtctctcaa cctttcaaaa acattctttc aaagatcaag ccactaaatc tgttatccct
     1081 gctatcaaat tgtgactgga cttttatggg ggtcgtcgag ctggtggtgt tgatagctga
     1141 actgtttgac atcttctgga cccctcctga tgtttccaac ttcatagcgt ctcttctgcc
     1201 tgatttccac ctgcaaggac cagaggattt ggctaaagat ctggttccac tgatattggg
     1261 gggtattggc ttggccattg gtttcaccag agataagata acaaaagtca tgaagagcgc
     1321 cgttgatggc ttgcgatcag ccacacagct cgggcaatat ggcctcgaga tattctcaat
     1381 catcaaaaag tatttctttg gtggagatca aaccgagaaa acccttaagg gcatagaaaa
     1441 tgctgtcata gacatggaag tcttgtcgag caccaatgtc acccagttgg tgcgcgataa
     1501 aaagttggct aagacctaca tgaacatcct agataatgaa gaagagaaag caagaaaact
     1561 ctcagtacgt agtgctgacc cacatgttgt aacaacggtc aacaatctca tttcgcgcat
     1621 atccatggcg cgttcagccc tcgccaaagc ccaagctgaa atgactagtc gggcgcgccc
     1681 agtagtcata atgatgtgtg gaccaccagg cataggaaaa actaaagctg ctgagcactt
     1741 agccaaccgc ttagctggtg aaataagacc agggggcaaa gtgggactgg tgcctagaga
     1801 atccattgac cattgggatg gctatcatgg ggaagaagtt ctattgtggg atgactatgg
     1861 catgtctaag ataacagagg attgcaacaa attgcaagcc atagctgaca ctgccccgtt
     1921 cacactcaac tgtgacagga tagagaacaa aggcatgcaa ttcgtgtcgg atgcaataat
     1981 aataacaaca aatgcccctg ggccagcccc cgttgacttt gtcaaccttg gtccagtgtg
     2041 tcgacgtgtg gacttcctgg tgtactgcac cgcccccgaa attgaacaga ctaggagaac
     2101 ccatcccgga gacaccaatg ctatcaaaga cctgttcaaa ccagactttt cccaccttaa
     2161 aatggagata gcaccacaag gggggtttga caatcaaggt aataccccct ttgggagggg
     2221 cgctatgaag ccaaccacac ttaataggtt actcatacaa gctgttgcac taacaatgga
     2281 aagacaagat gagttccaaa tgcaaggggc ggtgtataat tttgatgagg accgggtgac
     2341 agctttcacc agtttggccc gggccaatgg gctaggtctc ctgagtatgg cagcacttgg
     2401 aaaaagatta cggagtgtca acaacatgga aggacttcgc aatgctctca aggggtacaa
     2461 gatcactgag tgtgatattg tgtggaacaa tagaacttac accattaagg gggatggatc
     2521 aaatgtgagc atcactgaga aacaggtggc agcctctctc cagcagcaag ccgtcagctc
     2581 agtaaccctg gcgctttcta ggttgcgcgc cgcgcgagcg ctggcgtatg catcttgctt
     2641 tcagagcgca gtggttacca tcctacaaat ggccgggtct gcagtggtga tcagtagggc
     2701 agtcaaacgt atgttcggga cccacacaaa ccagccggcc ctggagggca aacccaagga
     2761 acacaactgc agagtccacc gtgctgaaag ggaaggccat ggacctattg ggcatgacgg
     2821 tatcatagaa cgatacggcc tgtgtgagag cgaccaggat gaggagaaga tcgtgatgga
     2881 agtgccaact gctgacaaag agggcaaaaa taaaggcaaa aacaagaagg ggcgaggcag
     2941 gaagaacaac tacaacgcct tttctaggcg aggcctgagt gatgaggagt atgaagaata
     3001 taaaaaggtt agagaagaaa agggtggcaa ctacagcatc caagagtacc ttgaggaccg
     3061 tcaacgttac gaagaagaac tcgctgaggt ccaagctggt ggagatggcg ggatcggtga
     3121 gacggaagca gagatccgcc atcgggtctt ctataaatcc aaaagtggta tgcgcaaaca
     3181 gcgccaagag gagcgccgac aacttgggct agttacgggt gctgaaatta ggaaacgcaa
     3241 acccatagac tggacaccgc caaaaaatga ctggtcagaa gatactaggg aagtcaatta
     3301 tgacgaacac atcagttttg aagccccacc ctctatttgg agtagggtcg taaaatttgg
     3361 cagtggatgg ggcttttggg taagttcaac agttttcatt acaaccacac acgtcatacc
     3421 accggatgct aaagaagttt ttggtgaaaa gctctcagac atagcaatac acagagttgg
     3481 ggaattcaca caatttagat tctccaaaaa gatgagacct gacctcagtg gtatggtatt
     3541 ggaagagggt tgcccagaag gaactgtatg cactataatg gtgaagagag actcaggtga
     3601 actgctacca ttggccgtgc gcatgggagc tgtcgcatcc atgaagatac agggaaagct
     3661 tatgcacggt caatctggca tgctgctaac tggtgcgaat gcaaagggaa tggatttagg
     3721 caccattcct ggtgattgtg gagctccata tgtacacaaa agaggaaatg attgggtggt
     3781 gtgtggagtg cacgcagccg caaccaagtc aggcaatact gttgtttgtg caatacagtc
     3841 aggtgaaggt gaagccactc ttgagggggg tggacaaaac aaagggcatt atgcaggcca
     3901 cccaatttta aggtatggta atgggccctc cctctctaca aaaaccaaat tttggaagtc
     3961 aactccccaa cccctccccc ctgggaccta cgaaccagcc tacttaggtg ggcgtgaccc
     4021 cagagtggat ggcggaccat cactccaaca ggtcctacgt gatcagctca agccttttgc
     4081 tgaaccccgt ggtaggatgc cagagccaag cttgctagaa gcagctgtgg agaccgtcac
     4141 aaacgtctta gagcaaacca tggacacgcc tgtgccatgg agttacagcg acgcctgcat
     4201 gtcgcttgac aagactacta gctcaggctt tccacaccac aaacgcaaga acgatgactg
     4261 gaatggcagt gcgtttgtgc gtgagcttgg tgaacaggca gcccatgcca acaacatgta
     4321 tgaattaggc aaatcagtca aaccagttta cactgcagca cttaaagatg aattggtgaa
     4381 acccgaaaaa gtgtatacaa agataaagaa aagattgctt tggggtgcag acctcggcac
     4441 agttattcga gctgctcgag cctttggccc attctgtgaa gctataaaac cacatgtgat
     4501 aaaattgccg attaaagtcg gcatgaatgc aattgaagat ggccccctca tatatgctga
     4561 acatgctaag tataaatatc actttgatgc agactacaca gcttgggatt caacacagaa
     4621 cagggagatt atgttagaat ccttcaacat catgtgtaag cttacagctg atccatcact
     4681 ggctgccatt gtcgcacagg acttgttgtc cccgtcggaa atggacgtgg gggactacgt
     4741 gattagtgtc aaggatggtc tcccctcagg attcccatgc acctcacaag tgaatagcat
     4801 aaatcattgg atttataccc tgtgcgccct ttcggaagtc acaggtttgg cccctgatgt
     4861 tctgcaatct caatcttact tttccttcta tggggatgat gaaattgtat caactgatgt
     4921 ggaatttgac ccaacaaaac tcacccaagt gcttagagag tatggcttga aacccacgcg
     4981 gcctgacaaa tcagaagggc ctatcatagt gaagcatcaa atagatgggt tagtttttct
     5041 gaggcgcact atatcaaaag atgctgctgg ctaccaaggg cgcctggacc gcaactccat
     5101 tgaaagacaa ttatggtgga cccggggccc aaaccacgat gatccctttg agacattgat
     5161 accccatcaa caaagaaaga ttcaattgat ttccttactt ggtgaggctg cgcttcacgg
     5221 agagaaattc tatagaaaga ttgccaacag agtcatacag gaagtcaaag aggggggcct
     5281 tgagctctat ataccaggtt ggcaggccat attccgctgg atgcgtttcc atgacttgag
     5341 cttgtggaca ggagatcgca atctcctacc cgattatgta aatgatgatg gcgtctaagg
     5401 acgccccctc aaacatggat ggcactagtg gtgccggtca gctggttcca gaggttaatg
     5461 cagctgaacc cctacccctt gagccggtgg tgggtgccgc aactgcggtg gccactgctg
     5521 ggcaagttaa tttaatagac ccctggatca tgaataattt tgtccaagcc cctgagggcg
     5581 aattcactat ctcccctaac aatacccctg gagatattct atttgatttg caattgggac
     5641 cacatcttaa tccttttctt caacatctgt cccaaatgta taatggttgg gtgggaaaca
     5701 tgagagttag agtcatgctc gcaggaaatg cgttcactgc tggtaaaatc ataatttgtt
     5761 gtgtcccacc tggctttgca tcccaaaata tatcaattgg acaagccaca atgttcccac
     5821 atgttatagc tgatgtgaga gtattagaac ctattgaaat cccccttgat gatgtacgca
     5881 atgtcttgtt tcacaccaat gaaagccgcc caactatgcg gttactctgt atgctgtaca
     5941 cacccctccg cgctggaggc gcttcatcag gcacggaccc ttttgtcatt gcaggtcgtg
     6001 tcctaacctg cccttcccct gatttcaatt ttctgttcct cgtacctcct agcgtggaac
     6061 agaagactag gcaattgact gtacccaata tacccttgaa caatttggcc aactccagag
     6121 tgcctgcaat gataaataag atgacagtct ccactgatca aagtcaggta gtccagttcc
     6181 aaaatggtcg ttgcacactc gaggggcaac ttttgggcac aacccctgtc tcagctagtc
     6241 aagtggcccg catacgcggt aaagttttct ccactgcatc tgggaaaggg ctcaatttaa
     6301 ctgaattgga tgggaccccc tatcatgcat tcgagagccc agcccccctt ggttttcctg
     6361 acataggagc ttgtgattgg catgtgtcaa ctttcaaggt ggatcaaaat ctttcagggg
     6421 accccatgtc caggctagat ataaaacaaa atgccccgtt tgcaccacat cttggttcca
     6481 ttgaattcac ctctgaccag gaaccaaccg gggatcaatt gggcacacta gcttgggtct
     6541 ccccttccac tagtggagct agggtcgatc cttggaaaat tccatcatat ggttcaactg
     6601 taactgagtc cactcacctg gcaccaccta tctttccgcc aggttttggt gaagccatag
     6661 tctatttcat gtcagacttt cccattgtgt caggcaacac tgctcaagtt ccctgtacct
     6721 tacctcaaga atttgtttca cactttgtgg aacaacaggc accaattcga ggtgaagctg
     6781 ccctattgca ttatgtagat ccagacaccc accgtaattt gggagagttc aaattgtacc
     6841 ctgatgggtt cattacctgt gtgccaaata caggcggtgg cccccaaaac cttcctataa
     6901 atggggtttt tgtcttttct tcttgggttt ctagatatta ccaattaaag cctgtgggaa
     6961 cagccggtcc ggccaggagg cttggtgtga gaagggtata atggctcaag ccattatagg
     7021 agcaattgcc gccaccgctg ctggcagcgc agtgggggca ggtatccaag ctggcacaga
     7081 agcagccctg caatatcaga gatttcaaca agatctcacc ctacaggaga actcttttaa
     7141 acatgatgag agaatgttgg gtttacaaat tgagggatct aatgctttat tacaaaagaa
     7201 tctttccact cgctataacc tattagttgg tgcaggtctt tcttcggctg atgctgcaag
     7261 gtctatcgtt ggggcccctg tgacaaaaat tgtggattgg aatggggtga ggattgccgc
     7321 ccctacgtcc actgccacca ctctccgatc tggcaatttt atgagcatac cagtcacgcc
     7381 gagaaaggag tcccaaaatc tgtcagcacg ttctgtaggt cttactaatc ctaactatga
     7441 ctcatctact atgatctcta gaacaaccca gtgggtggag tcacaaaatt cagctagaaa
     7501 tttatcacct tttcatagct cagccctaag gaccacatgg gtaactcctc ctggctctac
     7561 ttctacttca actttttcca ctgtctcttc ggtgccacgg ttctttaaca ccgagcgcct
     7621 tcccttgttc gcaaataata ggaagtag
//