Typing tool

Complete norovirus genomes

KX907727  GII.4 Sydney
 GII.P16

Length: 7,514 | 3 CDS

ORF1: 6..5105
ORF2: 5086..6708
ORF3: 6708..7514
LOCUS       KX907727                7514 bp    RNA     linear   VRL 07-NOV-2016
DEFINITION  Norovirus Hu/USA/2015/GII.P16_GII.4_Sydney/CA3477, partial genome.
ACCESSION   KX907727
VERSION     KX907727.1
KEYWORDS    .
SOURCE      Norovirus Hu/USA/2015/GII.P16_GII.4_Sydney/CA3477
  ORGANISM  Norovirus Hu/USA/2015/GII.P16_GII.4_Sydney/CA3477
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7514)
  AUTHORS   Collins,N., Vinje,J. and Aswath,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-SEP-2016) NCIRD/DVD/GRVLB, CDC, 1600 Clifton Rd NE,
            Atlanta, GA 30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7514
                     /organism="Norovirus
                     Hu/USA/2015/GII.P16_GII.4_Sydney/CA3477"
                     /mol_type="genomic RNA"
                     /strain="Hu/USA/2015/GII.P16_GII.4_Sydney/CA3477"
                     /host="Homo sapiens"
                     /db_xref="taxon:1914545"
                     /country="USA"
                     /collection_date="13-Nov-2015"
                     /note="genotype: GII"
     CDS             6..5105
                     /note="ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="APA31969.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDEPQKPPRPPTPELVKRIPPPPPNGEGEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     CDS             5086..6708
                     /note="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="APA31970.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRTDGSTRGHKAIVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAV"
     CDS             6708..7514
                     /note="ORF3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="APA31971.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGPSNKSS
                     SSSTATSVYSNQTISTRLGSTAGSGTSVSSLPSTARTKSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 ggtgaatgaa gatggcgtct aacgacgcta ccgttgccgt tgcttgcaac aacaacaacg
       61 acaaggaaaa atcttcaggt gaaggcttat tcacaaatat gtcttccacc ttaaagaaag
      121 ccctcggggc taggcccaaa cagcctgccc cgagagacga accacaaaag cccccaagac
      181 caccaactcc cgagttggtc aagaggatac cccctcctcc acctaatggc gaaggagaag
      241 aagaaccagt cattaggtat gaggttaaga gtgggatctc tggcctgccc gagctcacaa
      301 cagtccccca accggacgtg gccaacacag cattcagtgt tccaccactg agcttgagag
      361 aaaacaggga ggccaaggaa ccgctaacag gggcaatatt agagatgtgg gatggagaga
      421 tataccacta tggcctgtac gtggagaaag gcttagtgtt gggtgtgcac aaaccacctg
      481 cagccataag catggcaaga gtggagttga cgccgctgtc attgtactgg cgtgtggtgt
      541 acactcccca atacctcatc tcccctgaaa ctctcaggag gctcaacgga gaggcgttcc
      601 cttacaccgc ctttgacaac aactgctatg ccttttgctg ctgggtgtta gacctcaatg
      661 actcatggct tagcaggagg atggtgcaaa gaacaacggg cttcttcaga ccttaccaag
      721 agtggaacag aaaacccctg cctaccatgg atgactccaa aattaagaag gtagcaaata
      781 tattcctatg ttcattgtcc acactattca ccagacccat aaaagacctc ataggaaaaa
      841 ttaaaccatt aaacatattg aacatcctgg caacgtgtga ctggacgttt gccggaatag
      901 tggagtctct gatattactt gccgaactct tcggagtttt ctggacaccc ccagatgtgt
      961 ctgctatgat cgctccctta ctcggggact acgagttgca agggccagaa gacctcgccg
     1021 ttgaactcgt acctgtggta atgggaggga ttggtttggt gttgggattc accaaagaga
     1081 aaattggcaa aatgttgtcc tcagcagcat caacactcag ggcttgcaaa gatcttggtg
     1141 cctatggctt agagatactc aaattggtca tgaagtggtt cttcccaaag aaagaggagg
     1201 ccaatgagct agccatggtg agggccatag aggatgccgt actagatctt gaggcaatag
     1261 aaaataacca catgacaacc ctgttgaaag acaaagacag cttagcaaca tacatgaaaa
     1321 cactggacat ggaggaggag aaagccagaa ggttgtccac aaaatctgca tcccctgaca
     1381 tagttgggac aatcaacgcc ctgctggctc gaatagcagc ggccaggtca ttagtccaca
     1441 gggccaagga agagctgtct agcaggataa gaccagtagt tgttatgata tctggcaaac
     1501 caggaatagg caaaactcat ctggccaggg aggtggcaag aaaggtggca tccactctca
     1561 caggggatca aagagtcgga ctcataccaa gaaacggtgt ggaccattgg gatgcataca
     1621 aaggtgagag agtcgtgctg tgggacgact atggcatgag taaccccatt catgatgctc
     1681 ttcgcataca agaattggct gatacgtgtc cccttacctt aaattgtgac agaattgaaa
     1741 ataagggaaa agtttttgac agtgaagtca taataattac aacaaacctt gccaatccag
     1801 ccccacttga ttatgtcaac tttgaggcct gttccaggag aattgatttc ctggtgtacg
     1861 ctgaggcacc agaagtagaa aaggcaaaac gggactttcc tggtcagcca gatatgtgga
     1921 aggacgcctt caagtcggac ttctcacaca tcaagctaca gcttgcacct cagggcggct
     1981 ttgacaagaa tggcaacacc ccacatggga aaggagtgat gaagaccctc actaccggtt
     2041 ctctgattgc ccgtgcgtca ggcctactgc atgagaggat ggatgaattt gaactccaag
     2101 gtcccacaat caccaccttc aatttcgacc ggaacagaat cacagcattc agacaattgg
     2161 ctgcagaaaa caagtatgga ttggtggata ccatgaaagt tggcaatcaa ctaaaaggag
     2221 tgaaaaccat ggaagaactc aaacaagcaa tcaggaatgt gaccatcaag aggtgccgga
     2281 tcatctacgg tggctccacg tatgaccttg aatctgatgg caagggcaaa gttttggtgg
     2341 aaaaggtcaa gaacacctct gtacagacca acaacgagtt ggccggggcc ctgcaccatc
     2401 tcaaacacgc ccgaatcagg tactatgtca aatgtgtgca agaagcagtc tattccatca
     2461 tacaaattgc cggcgctgcg tttgtcacca cgcgcattgc acgccgcatg aacatacaag
     2521 aactctggtc gaagccacaa ttagatcaaa atgaatcaga aactaaggaa gaggccccca
     2581 agtcagaaga tgacgagttc atcatatctt ctaaggacat caaggaggaa ggaaagaagg
     2641 gcaaaaacaa aactggccgt ggcaagaaac acactgcatt ctccagcaag ggcttgagcg
     2701 atgaggagta tgacgagtac aagaggataa gagaagagag aaatgggaag tactctatag
     2761 aggagtacct tcaagataga gacaggtact atgaggagct cgccattgcc aaggccacgg
     2821 aagaagactt ctgtgaagag gaggagatca aaatccgtca gagaattttc cgtcccacca
     2881 ggaaacaaag aaaggaagag agggccacat tagggctagt aacaggttca gaaatcagaa
     2941 aaagaaaccc tgatgacttc aaacccaaag ggaagctgtg ggccgatgac aacagaagtg
     3001 ttgactacaa tgagaaactg gactttgagg cccccccaag catatggtct aggattgtga
     3061 gctttggttc tggctggggc ttctgggtat caccaagcct gttcataaca tcaactcatg
     3121 tgatccccgc aggcataaca gaagcatttg gagtccccat caaacaaatt cagatccaca
     3181 aatcaggtga attttgccga ttcagattcc caaaaccaat tagaccagat gtgacaggaa
     3241 tgatcttgga agaaggtgcg cctgaaggca ccgtggcaac tgtgctcatc aaacgcccca
     3301 ccggagagct catgcctctt gcagccagaa tgggaacaca cgcaaccatg aaaattcaag
     3361 gccgcatggt tggcggacag atgggtatgt tgctcactgg atcaaatgct aaaggaatgg
     3421 atttgggaac aactcctggt gactgtggct gtccttacat ctataaaagg ggcaatgact
     3481 atatagtcat tggggtgcac actgcagcag cccgtggtgg aaacaccgtt atctgtgcca
     3541 cacagggaag tgagggtgag gcaactcttg agggtggaga tgacaaagga acatactgtg
     3601 gggcacccat tctaggccct gggggtgcac caaaattgag caccaaaacc aaattttgga
     3661 ggtcatcgaa cacgcccctt ccaccaggga catatgagcc tgcctacctc ggtggccgtg
     3721 atccgcgtgt taagggtggg ccctccttgc agcaggtaat gagagaccag ttgaagccat
     3781 tcactgaacc caggggcaaa cctccaagac caagtgtatt ggaagcagcc aaacaaacca
     3841 ttatcaacgt cctcgaacaa accctggatc ctccacaaaa atggacatac gcacaggcgt
     3901 gtgcctcact tgacaaaacc acctccagcg ggcatcccca tcacgtccga aagaatgaat
     3961 tctggaatgg tgagaccttc actggtaaat tggcagacca agcatcaaaa gcaaacctaa
     4021 tgtttgagga agggaaacac atgacaccag tgtatacagc agcactcaag gacgagctag
     4081 tcaagactga gaaaatctat ggaaagatca agaagagact gctctggggc tctgacttgt
     4141 ccaccatgat ccggtgcgct aggtcatttg gtgggctcat ggacgagatg aaggcacact
     4201 gcatatcact cccagtacga gttggcatga atatgaatga agatggccca ataatatttg
     4261 agaaacattc cagatacaaa taccactatg atgcagacta ctctcgttgg gattcaacac
     4321 aacagagggc agtgctagca gcagccttgg aaatcatggt cagattctct gcagaaccac
     4381 aattggcaca aatagtcgct gaggatctgc tggcccctag tgtagtagat gtaggagact
     4441 ttaaaatcac aataaatgaa gggctcccat ctggtgtgcc atgcacttct caatggaact
     4501 ccatcgcaca ctggctgcta actctctgtg ccttgtctga agtcaccaaa ctgtcccctg
     4561 acattgtaca agcaaattcc atgttctcat tttacggtga tgacgagatt gtcagcaccg
     4621 acataaaatt ggaccctgaa cagttaaccg ccaaattgaa ggagtacggc ctgaaaccaa
     4681 cccgcccaga caagaccgag ggacccctga tcatcagtga agatttgaac ggactcactt
     4741 tcctccgaag gacggtgact cgtgacccag ctggctggtt tggaaaactg gaccaaagct
     4801 caattttgag gcagatgtac tggactagag gaccaaatca tgaagacccc aatgagacaa
     4861 tgatacccca ttctcaaaga cccatacagc tcatggcact gcttggtgaa gcctctcttc
     4921 acggaccctc tttctacagt aaaatcagta aattggtcat aactgaactc aaagaaggtg
     4981 ggatggactt ttacgtgcca aggcaggaac ccatgttcag gtggatgagg ttttctgact
     5041 tgagcacgtg ggagggcgat cgcaatctgg ctcccaattt tgtgaatgaa gatggcgtcg
     5101 agtgacgcca acccatctga tgggtccgca gccaacctcg taccagaggt caacaatgag
     5161 gttatggctt tggagcccgt tgttggtgcc gctattgcgg cacctgtagc gggccaacaa
     5221 aatgtaattg acccctggat tagaaataat tttgtacaag cccctggtgg ggagtttaca
     5281 gtatccccta gaaacgctcc aggtgaaata ctatggagcg cgcccctagg ccctgaccta
     5341 aatccctacc tatcccattt ggccagaatg tacaatggtt atgcaggtgg ttttgaagtg
     5401 caggtaattc tcgcggggaa cgcgttcacc gccgggaaga tcatatttgc agcagtccca
     5461 ccaaattttc caactgaagg cttaagtcct agccaggtca ctatgttccc ccatataata
     5521 gtggatgtta gacaattaga acctgtgctg attcccttac ccgatgtcag gaataatttc
     5581 tatcattaca atcagtcaaa tgatcccact attaagttga tagcaatgtt gtatacacca
     5641 cttagggcta ataatgctgg ggatgatgtt ttcacagttt cgtgccgagt tctcacgaga
     5701 ccatcccccg attttgattt catattttta gtgccaccca cagttgagtc aagaactaaa
     5761 ccattctctg tcccagtttt aactgttgag gagatgacca attcaagatt ccccattcct
     5821 ttggaaaagt tgttcacggg ccccagcagt gcctttgttg ttcaaccaca aaacggcagg
     5881 tgcacaactg atggcgtgct tctaggcacc acccaactgt ctcctgtcaa catctgcacc
     5941 ttcagagggg atgtcaccca catcacaggt agtcgcaact acacaatgaa tttggcttct
     6001 caaaattgga acaactatga cccaacagaa gaaatcccag cccctctagg aactccagat
     6061 tttgtgggga agatccaagg catgctcacc caaaccacaa ggacagatgg ttcaacacgc
     6121 ggccacaaag ctatagtgta cactgggagc gccgactttg ctccaaaact gggtagagtt
     6181 caatttgaaa ctgacacaga ccatgatttt gaagctaacc aaaacacaaa gttcacccca
     6241 gtcggtgtca tccaagatgg tagcaccacc caccgaaacg aaccccaaca gtgggtgctc
     6301 ccaagttact caggcagaaa tactcacaat gtacatctgg cccctgctgt agcccccacc
     6361 tttccgggtg agcaacttct cttcttcaga tccaccatgc ccggatgcag cgggtacccc
     6421 aacatggatt tggactgtct gctcccccag gaatgggtgc agtacttcta ccaagaggca
     6481 gccccagcac aatctgatgt ggctctgcta agatttgtga atccagacac aggtagggtt
     6541 ttgtttgagt gcaagcttca caaatcaggc tatgttacag tggctcacac tggccaacat
     6601 gatttggtta tcccccccaa tggttacttt aggtttgatt cctgggtcaa ccagttctac
     6661 acgcttgccc ccatgggaaa tggaacgggg cgtagacgtg cagtataatg gctggagctt
     6721 tctttgctgg attggcatct gatgtccttg gctctggact tggttccctt atcaatgctg
     6781 gggctggggc catcaaccaa aaagttgagt ttgaaaataa cagaaaattg caacaagcat
     6841 ccttccaatt tagcagcaat ctgcaacagg cttcctttca acatgataaa gagatgctcc
     6901 aagcacaaat tgaggccacc aaaaagctac aacaggaaat gatgaaagtt aagcaggcaa
     6961 tgctcctaga gggtgggttc tctgagacag atgcagcccg cggggcaatc aacgccccca
     7021 tgacaaaagc tttggactgg agtgggacaa ggtactgggc tcccgatgct aggactacaa
     7081 catacaatgc aggccgcttt tccacccctc aaccatcggg ggcactgcca ggaagagcta
     7141 atcttaggga tgctgtccct gctcggggac cctccaacaa atcttctagc tcttctactg
     7201 ccacctctgt gtattcaaat caaactatct caacgagact tggttctaca gctggttctg
     7261 gaaccagtgt ctcgagcctc ccgtcaactg caaggactaa gagctgggtt gaggatcaaa
     7321 gtaggaattt gtcacctttc atgagggggg cccacaacat atcatttgtc accccaccat
     7381 ctagcagatc ctctagccaa ggcacagtct caaccgtgcc taaagagatt ttggactcct
     7441 ggactggcgc tttcaacacg cgcaggcagc ctctcttcgc tcacattcgt aagcgagggg
     7501 agtcacgggt gtaa
//