Typing tool

Complete norovirus genomes

KX586330  GII.4 Sydney
 GII.P31

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       KX586330                7509 bp    RNA     linear   VRL 30-MAY-2017
DEFINITION  Norovirus GII isolate Hu/NOV/GII/CHN/ZJ01, complete genome.
ACCESSION   KX586330
VERSION     KX586330.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7509)
  AUTHORS   Shen,Q. and Rui,Z.
  TITLE     The genomic sequence analysis of human Norovirus strain in
            Zhenjiang
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Shen,Q. and Rui,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2016) School of Medicine, Jiangsu University, 301
            Xuefu Road, Zhenjiang, Jiangsu 212013, China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: genious v. 4.8.2
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/NOV/GII/CHN/ZJ01"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China"
                     /collection_date="10-Jul-2015"
                     /note="genotype: GII-4"
     CDS             1..5100
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ART66971.1"
                     /translation="MKMASNGASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPLTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLMDTMRVGKQLKDVKTM
                     SDLKQALKNIAIKKCQIVYNGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEETANKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ART66972.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRTDGSTRGHKATVYTGSADFAPKPGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ART66973.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKPS
                     NSSTVTSVYSNQTTSTRLGSTAGSGTSVSSFPSTARTRNWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 atgaagatgg cgtctaacgg cgcttccgct gccgctgttg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgttttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gaaataccac ccagaccccc gcgaccactc
      181 acaccagaat tggtcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcgccaaaga tggcgtttcc ggactgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gtttagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaatcatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcata agccaccggc agccattagc
      481 cttgccaagg tcgagctagc accgctctct ttgttctgga gacctgtata caccccccag
      541 tatctcatct ctccagacac tcttaggaga ttacatggag agtcattccc ctacactgca
      601 tttgataata attgctacgc cttttgttgt tgggtgttag acctgaacga ctcatggcta
      661 agcaggagaa tgattcagag aacaacaggc ttctttaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac caggcccatt aaggacataa tagggaagtt gaaacctctt
      841 aacatcctta acattctggc tacatgtgat tggaccttcg caggcatagt ggaatcctta
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta tgaactgcaa ggacctgagg accttgcagt ggaactggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aatcggaaag
     1081 atgctatcat ccgctgcatc cactttaaga gcttgtaaag accttggtgc atacggactg
     1141 gaaatcttaa aattggtcat gaaatggttc ttcccaaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagtg ctagacctcg aggcaattga aaacaaccac
     1261 atgactaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccagaaa gctctcaacc aaatctgctt cacccgatat tgtgggcaca
     1381 atcaactctc ttctggcaag aatcgctgct gcacgttccc tagtgcatcg ggcgaaagaa
     1441 gagctctcca gcaggccgag acctgtcgtt gtgatgatat cgggaagacc agggataggg
     1501 aagactcacc ttgccaggga gttggccaag aagatcgcgg cctccctcac aggggaccag
     1561 cgtgtgggtc ttatcccacg caatggtgtc gaccactggg acgcatacaa gggcgaaaga
     1621 gttgtcctgt gggacgacta tggaatgagc aaccccatcc atgatgccct caggttgcag
     1681 gagcttgctg acacttgccc cctcacgcta aattgtgaca gaattgagaa caaaggaaag
     1741 gtctttgaca gtgatgccat aattatcacc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact ttgaagcgtg ctcgagacgc attgatttcc tcgtgtacgc agaagcccct
     1861 gaggtggaga aggcaaagcg cgacttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatggaaa aggggtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcatcag ggttactcca tgagaggcta gatgaatatg aactgcaagg cccagccctc
     2101 accactttca actttgaccg caacaagata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgatggacac aatgagagtt ggaaaacagc tcaaggatgt caagaccatg
     2221 tcagacctca aacaagcact caagaacatc gcgatcaaga agtgccagat agtgtacaat
     2281 ggtggcacct acacacttga ggctgatggc aagggtagtg tgaaagttga caaagtgcaa
     2341 agtgccactg tgcagaccaa caatgaacta gccggtgccc tacaccacct gaggtgcgct
     2401 agaatcagat actatgttaa gtgcgtccag gaggcactgt attccatcat ccaaatcgct
     2461 ggggctgcat tcgtcaccac gcgcatcgct aagcgcatga atatacagaa tctctggtcc
     2521 aagccacagg tggaagacac agaagagacg gccaacaaag atggttgcct aaagcccaaa
     2581 gatgatgaag agtttgtcgt ctcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagtccg gccgtggcaa gaagcacaca gccttttcaa gtaaagggct cagtgatgag
     2701 gagtacgatg agtacaagag aatcagagaa gaaagaaatg gtaagtactc catagaagag
     2761 taccttcagg acagagacag gtactacgag gaggtggcca ttgccagggc aaccgaagag
     2821 gacttctgtg aagaagaaga ggccaaaatc cggcagagaa ttttcagacc aacaaggaaa
     2881 caacgtaaag aagagagggc ctctctcggc ttggtcacag gctctgaaat caggaagaga
     2941 aacccagaag acttcaaacc caagggaaag ctgtgggctg atgatgacag aagtgtagac
     3001 tacaatgaga aactcaactt tgaggcccca ccaagcatct ggtcgcggat agtcaacttt
     3061 ggttcaggct ggggcttctg ggtctccccc agtctgttta taacatcaac ccatgtcata
     3121 ccccaaggtg caaaagagtt cttcggagtc cctatcaagc aaatccagat acacaagtca
     3181 ggtgaattct gccggttgag attcccaaag ccaatcagaa ctgatgtgac gggcatgatt
     3241 ctagaagaag gtgcgcccga ggggaccgtg gccacactgc tcatcaagag accaactgga
     3301 gagctcatgc ctctggcagc cagaatgggg acccatgcaa ccatgaaaat tcaggggcgc
     3361 acagttggag ggcaaatggg tatgctcctg acaggatcca acgccaagag tatggaccta
     3421 ggcacaacac caggtgactg cggctgcccc tacatctaca agagggggaa tgactacgtg
     3481 gtcatagggg tccatacggc cgctgcccgt ggagggaaca ctgtcatatg tgccacccag
     3541 gggagtgagg gggaagccac acttgaagga ggtgacagca aagggacata ctgtggcgca
     3601 ccaatcttgg gcccagggag cgctccgaag ctcagtacca agactaagtt ttggagatca
     3661 tccacaacac cactcccgcc tggcacttac gaaccagcct acctcggtgg caaagaccct
     3721 agagtcaaag gtggcccttc attgcaacaa gttatgaggg accagctgaa gccattcaca
     3781 gaacccagag gcaaaccacc aagaccaaat gtgttggaag ctgccaagaa aaccatcatc
     3841 aatgtccttg agcaaacaat tgatccaccc caaaaatggt catttgcgca agcttgcgca
     3901 tcccttgaca aaaccacctc cagcggccac ccgcaccaca tgcggaaaaa cgactgttgg
     3961 aatggggagt ccttcacagg aaaattggct gatcaagcct ccaaggccaa cctaatgttt
     4021 gaagagggaa agaacatgac tccagtctac acaggtgcac ttaaagatga gttggtgaag
     4081 accgataaag tttatggtaa ggtcaagaag aggcttctgt ggggttcaga tctggcgacc
     4141 atgatacggt gcgcccgagc ttttgggggc cttatggatg aactcaaggc acactgtgtc
     4201 acacttcctg tcagagttgg tatgaacatg aatgaggatg gccccatcat ctttgagaag
     4261 cactccagat atagatacca ctatgatgct gattattccc ggtgggactc aacacaacaa
     4321 agggatgtgc tagcagcagc actagaaatc atggttaagt tctctccaga accacacctg
     4381 gcccagatag ttgcagaaga cctcctttcc cctagcgtga tggatgtagg tgactttcaa
     4441 atatcaataa gtgagggtct cccctctggg gtaccttgta cctcccagtg gaattccatc
     4501 gcccactggc tcctcactct gtgcgcactc tctgaagtca cggacctgtc ccctgatatc
     4561 attcaggcca actccctctt ttccttctat ggtgatgatg agattgtaag cacagacata
     4621 aagttggacc cagagaagct gacagcaaaa ctcaaggagt acgggctgaa accaacccgc
     4681 cccgacaaaa ctgaaggacc ccttgttatc tctgaagacc tggatggcct gacattcctc
     4741 cggagaactg tgacccgtga tccagctggc tggtttggaa aattggaaca aagttcaatt
     4801 ctcagacaaa tgtactggac cagaggtccc aaccatgaag atccatttga aacaatgata
     4861 ccacactccc aaagacccat acaattgatg tccttgctgg gcgaggctgc actccacggc
     4921 ccggcattct atagcaaaat tagcaaatta gtcattgcag agttgaagga aggtggcatg
     4981 gacttttacg tacccagaca agagccaatg ttcagatgga tgagattctc ggatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgagtga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctctggag cccgttgttg gtgccgctat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt ttacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttgggccctg atctaaatcc
     5341 ctacctatcc catttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aattctcgcg gggaacgcgt tcaccgccgg gaaggtcata tttgcagcag tcccaccaaa
     5461 ttttccaacc gaaggcttga gccccagcca ggtcactatg ttcccccata tagtagtaga
     5521 tgttaggcaa ttagaacctg tgttgattcc cttacccgat gttaggaata atttctatca
     5581 ttacaatcaa tcaaatgatc ccaccattaa gttgatagca atgttgtaca caccacttag
     5641 ggctaataat gctggggatg atgtcttcac agtttcttgc cgagttctca cgagaccatc
     5701 ccccgacttt gatttcatat ttctagtgcc acccacagtt gagtcaagaa ctaaaccatt
     5761 ctctgtccca gttttaactg ttgaggagat gaccaattca agattcccca ttcctttgga
     5821 aaagttgttc acgggtccca gcagtgcctt tgttgtccaa ccacaaaacg gtaggtgcac
     5881 gactgacggc gtgctcctag gcaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggagatgtc acccatatca caggtagtcg taactacaca atgaatttgg cttctcaaaa
     6001 ttggagcaat tatgacccaa cagaagaaat cccagcccct ctaggaactc cagattttgt
     6061 ggggaagatt caaggcatgc tcacccaaac cacaaggaca gatggctcaa cacgcggcca
     6121 caaagccaca gtgtacactg ggagcgccga ctttgctcca aaaccgggta gagttcaatt
     6181 tgaaactgac acagaccatg attttgaagc taaccaaaac acaaagttca ccccagttgg
     6241 tgtcatccaa gatggtagca ccacccaccg aaatgaaccc caacagtggg tgctcccaag
     6301 ttactcaggc agaaatactc ctaatgtgca tctggccccc gctgtagccc ccacttttcc
     6361 gggtgagcaa cttctcttct tcagatccac catgcccgga tgcagcgggt accccaacat
     6421 ggatttggac tgtctgcttc cccaggaatg ggtgcagtac ttctaccaag aggcagcccc
     6481 agcacaatct gatgtggctc tgctaagatt tgtgaatcca gacacaggta gggttttgtt
     6541 tgagtgtaag cttcataaat caggctatgt cacagtggct cacactggcc aacatgattt
     6601 ggttatcccc cccaatggtt attttaggtt tgattcctgg gttaaccagt tttacacgct
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcacta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttggctct gggcttggtt cccttatcaa tgctggggct
     6781 ggggccatca accaaaaagt tgagtttgaa aataacagaa aattgcaaca agcatccttc
     6841 caatttagca gtaatctaca acaggcttcc tttcaacatg acaaagagat gctccaagca
     6901 caaattgagg ccaccaaaag gctacaacag gaaatgatga aagttaagca ggcaatgctc
     6961 ctagagggtg ggttctctga gacagatgcg gcccgcgggg caatcaacgc ccccatgaca
     7021 aaagctttgg actggagcgg gacaaggtac tgggctcccg atgctaggac tacaacatac
     7081 aatgcaggcc gcttttccac ccctcagcca tcgggggcac tgccaggaag agctaatctt
     7141 agggatgctg tccctgcccg gggttcctcc agtaagcctt ccaattcttc cactgttact
     7201 tctgtgtact caaatcaaac tacttcaacg agacttggtt ctacagctgg ttctggtacc
     7261 agtgtctcga gcttcccgtc aactgcaagg actaggaact gggttgagga tcaaagtagg
     7321 aatttgtcac ctttcatgag gggggcccac aacatatcgt ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag agattttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagccactc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgggcgtaa
//