Typing tool

Complete norovirus genomes

KX356908  GII.17
 GII.P17

Length: 7,556 | 3 CDS

ORF1: 5..5113
ORF2: 5094..6716
ORF3: 6716..7495
LOCUS       KX356908                7556 bp    RNA     linear   VRL 16-JUL-2016
DEFINITION  Norovirus GII.17 strain GII.17/KM1509/CHN/2015, complete genome.
ACCESSION   KX356908
VERSION     KX356908.1
KEYWORDS    .
SOURCE      Norovirus GII.17
  ORGANISM  Norovirus GII.17
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7556)
  AUTHORS   Liu,H., Liu,B., Li,C.I., Tao,Y., Li,X., Liu,J. and Li,C.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2016) Infection and Immunity Laboratory,
            Institute of Medical Biology, Chinese Academy of Medical Science,
            935 Jiaoling Road, Kunming, Yunnan 650118, China
FEATURES             Location/Qualifiers
     source          1..7556
                     /organism="Norovirus GII.17"
                     /mol_type="genomic RNA"
                     /strain="GII.17/KM1509/CHN/2015"
                     /isolate="KM1509"
                     /isolation_source="feces"
                     /host="Macaca mulatta"
                     /db_xref="taxon:552592"
                     /country="China"
                     /collection_date="2015"
                     /note="genotype: GII.17"
     CDS             5..5113
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ANR94979.1"
                     /translation="MKMASNDASAAVAGKNNNNDKEKSSSDSLFANMSVTFKKALGAR
                     SKQPPPGETKQTQKPPRPPTPELVKRTPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVV
                     QPDAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPA
                     AISLAKIEITPLSLYWRVVYTPQYLVDPGTLKNLSGETFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRMIQRTTGFFKPYQDWNRKPLPTMDEPKIKKAADAVLCALSSLFTRPIKDI
                     IGKLRPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQG
                     PEDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKW
                     FFPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARK
                     LSTKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLA
                     RELAKKVASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDAIIVTTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     IEKAKRDFPGQPDMWKDHYRPDFSHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLI
                     ARASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSV
                     KTLDELKQAIKNISIKKCQIVYNGCTYTMESDGRGKVVVEKVQNATVQTNNELVGALH
                     HLRSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDEPEDR
                     GGCPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREE
                     RNGKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATL
                     GLVTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFW
                     VSPSLFITSTHVIPKGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGA
                     PEGTVVSILIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKNMDLGTT
                     PGDCGCPYIYKRGNDLVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKN
                     DYWSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWG
                     SDLSTMIRCARAFGGLMDEFKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYS
                     RWDSTQQRAVLEAALEIMVRFSAEPQLAQTVAEDLLSPSVVDVGDFKIAINEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWT
                     RGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVP
                     RQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5094..6716
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="ANR94980.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLSSDICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
                     VSQRNVGSDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
                     DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
                     CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDHPLV
                     VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     CDS             6716..7495
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="ANR94981.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDKEMLQAQVRATKQLQSEMIALKQGVLAAGGFSPTDAARGSIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMSSPNAPQSKPAKPRSLAPSSSSSSVYSMYTQST
                     HLTSGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRF"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgtt gctggcaaaa acaacaacaa
       61 cgacaaggaa aaatcttcaa gtgacagctt gtttgctaac atgtctgtta cttttaagaa
      121 agccctcggg gcgcggtcta aacaaccgcc cccgggagaa acaaaacaaa cacaaaaacc
      181 accaaggcca ccgacaccgg aattggtgaa gagaacacct ccacccccac ccaatggcga
      241 ggatgaacca gggatagtgt acaaggtggg agagggtgtg tctgggctgc ccgacctaac
      301 aactgtggta caacctgacg cacaaaacac agcttatagt gttcccccac ttagccagag
      361 agaagtcggc gaagctaaag aaccgcttcc tggctccatt ctggaaatgt gggatggtga
      421 gatctaccac tatgggctgt atgttgagcg ggggcatgtg ctcggagtac acaaaccacc
      481 tgctgcaata agccttgcca aaattgaaat aacaccgctg tctctctact ggagagtggt
      541 ctacactccc cagtatttgg tagatcctgg aactcttaag aacttgagtg gagagacttt
      601 cccatacacg gcctttgaca acaactgtta tgccttctgt tgttgggtcc tagacctcaa
      661 cgactcctgg cttagcagga gaatgatcca aagaacaact ggattcttca aaccttatca
      721 ggattggaac agaaaaccct taccaaccat ggatgaaccg aaaatcaaga aggccgcgga
      781 tgctgtccta tgcgctctct cctcactctt cactagaccc attaaggaca tcattggaaa
      841 gcttagacca ctgaacattc ttaatatact ggcaacctgc gattggactt ttgcaggcat
      901 agtggaatcc ttgatccttc ttgctgaact ctttggggtg ttctggacac ccccagatgt
      961 gtctgcgatg attgctccct tactcggaga ctacgagatg caaggccccg aagacctggc
     1021 cgtggaactt gtgcccgtgg tgatgggagg aataggtttg gtgttaggat tcaccaaaga
     1081 aaagatcggc aagatgcttt catcagctgc gaccacactt agggcctgca aggatctagg
     1141 atcttatgga ttggagatac tcaaattggt catgaagtgg ttcttcccca agaaggagga
     1201 ggctaacgaa ctagccatgg tgagggccat tgaggatgca gtcctggatt tggaggcaat
     1261 agaaaacaat cacatgacca cccttctcaa ggataaagac agcctggcca catacatgag
     1321 gactcttgac ttggaagaag agaaagcaag gaaactgtca accaaatcgg catcacctga
     1381 catcgtgggt acaataaacg cattattggc taggatagca gccgccaggt cactggtcca
     1441 caaggctaag gaggagctct cgagcagaca gagacctgtt gttgtaatga tatcaggtag
     1501 accaggtata ggaaagaccc atctggccag agagctagcc aagaaagttg cgtcaacact
     1561 gtcaggcgac caaaggattg gactggtacc tagaaatggc gtcgaccatt gggacgccta
     1621 caagggagaa agggtggttc tgtgggatga ttatggtatg agcaacccta tacaggacgc
     1681 actgaggctc caagaattgg ctgatacctg tcctctgacc ctaaattgtg ataggattga
     1741 aaacaaagga aaagtgttcg atagtgatgc cataattgta acaaccaacc ttgcaaaccc
     1801 agcgccacta gactatgtca actttgaggc ctgctctaga cgcatagact tcttggtgta
     1861 tgcagacgca cctgacattg agaaggctaa gcgtgacttc cctggccaac cagatatgtg
     1921 gaaagaccat tacagaccag acttctcaca cattaaactt cagctggcac cacagggagg
     1981 ttttgacaaa aatggcaaca ccccacatgg caaaggtgtg gtgaagtccc tgacgattgg
     2041 ttctctgatc gccagggcct ccggcttgct ccacgagaga atggatgagt tcgagctcca
     2101 aggctctgac ctgccaacct tcaattttga ccgcaacaaa gtcgccgcct tcagacaatt
     2161 agcagctgaa aacaaatatg gtcttatgga cacactgagg gtcggcaacc aactgaaaag
     2221 tgttaagacc ttggatgagc tgaagcaggc cataaagaac atcagtatca agaagtgtca
     2281 gatagtgtat aatggatgca cctataccat ggaatctgat gggaggggca aggttgtggt
     2341 tgaaaaggtg caaaacgcaa cagttcaaac caacaatgaa cttgtagggg cgctccacca
     2401 cctgagatct gcaaggataa gatactatgt taaatgtttc caagaagcca tttactctct
     2461 actccaaatt gctggtgcag ccttcgtcac ctcacgcatc gtgaggcgca tgaacatatc
     2521 aaacctctgg tcgaagccac ccatcgagga gggtgatgag cctgaagaca gaggaggatg
     2581 ccccaagccc agggatgaag atgacctcac tattgactct agagacatta aagtggaagg
     2641 gaagaagggc aagaacaagt ctggccgggg caagaaacac acagccttct cttccaaggg
     2701 cctcagtgat gaagagtacg atgagtacaa gagaatcaga gaggagagga atggcaaata
     2761 ctcaatagag gaatacctcc aagataggga cagatactat gaagagcttg ccattgctaa
     2821 ggccactgag gaggacttct gtgaggagga ggagatcaaa atccgccaga gaatcttccg
     2881 acccaccagg aagcagcgaa aagaggaaag ggccacgctt gggcttgtca caggatcgga
     2941 aatcagaaag aggaacccag atgactttaa accaaaagga aaattgtggg ctgatgacaa
     3001 caggagcgtg gactacaatg agaggataga ttttgaggct cccccgagtg tttggtctag
     3061 gatagtcaac tttggcacag gctggggatt ctgggtttct ccaagtctct ttataacttc
     3121 aacacacgtc ataccaaaag gaatcactga ggcctttgga gtgcccataa accaaatcca
     3181 aattcacaaa tctggagaat tttgccgctt gcggtttcca aagccaatca gaccagacgt
     3241 gagtgggatg atcttggaag agggcgcccc tgaaggcact gttgtgtcta ttctcatcaa
     3301 aaggacaaca ggggagctga tgcctcttgc agtcagaatg gggactcatg ccacaatgaa
     3361 aatccaaggt agaacggtgg gtggtcagat gggtatgctt ctcactggct caaatgctaa
     3421 aaacatggat ctgggcacaa cgccaggtga ctgcgggtgt ccatacatat acaaaagggg
     3481 caatgacctt gtggtcattg gggtgcacac tgcagcagct cgtggaggca acacggtcat
     3541 atgtgccaca cagggaagtg aaggtgaagc cactcttgaa ggaggtgaca acaagggtac
     3601 ctattgtgga gcccccattt tgggacctgg caatgcacca aaattgagca caaagacaaa
     3661 attctggaga tcctctaacg caccgcttcc cccaggtact tatgaaccag cgtaccttgg
     3721 tgggagagac ccgcgcgtga agggaggccc atctctgcaa caagttatga gagaccaact
     3781 taaacctttt acagagccca gagggaagcc accaaaccca aatgtcttag agtcagcaaa
     3841 gaagactatc attaatgttc tggaacaaac cattgacccc cctcaaaagt ggtcatatgc
     3901 ccaagcttgt gcatccctcg acaagacaac ctccagtgga tacccgcacc acgtccggaa
     3961 gaatgactat tggagtggtg aatccttcac aggaaaactt gcagatcagg cttcaaaagc
     4021 aaatctcatg tatgaggaag gcaagcacat gcaaccagtt tacaccgcag cactcaaaga
     4081 cgagctcgtg aaaactgaca aaatttatgg caaaatcaag aaaagactcc tgtggggttc
     4141 tgacctctcc acaatgattc gatgcgccag agcatttggt ggtctcatgg atgaattcaa
     4201 agcaaattgt attacactcc ctatcagagt tggtatgaat atgaatgaag atggccccat
     4261 aatatttgag aaacactcca ggtacaggta ccactatgat gctgattact cccgctggga
     4321 ctccacacaa cagcgggcgg tgctggaagc ggcacttgaa atcatggtga gattttctgc
     4381 tgagccacag ctggcacaaa cagtggcaga ggacctgctg tcaccaagtg tggtcgatgt
     4441 gggcgatttc aaaatcgcta tcaatgaagg cctaccatct ggtgtgcctt gcacctcaca
     4501 atggaattct attgcccact ggttacttac cttgtgtgcc ctttctgaag tgacaggatt
     4561 aggtcctgac atcatacaag ctaactccat gtactctttc tatggtgatg atgagattgt
     4621 gagcacagac ataaaattgg acccagagaa attgaccgca aagctcaaag aatatggcct
     4681 taaacccact cggcccgaca aaactgaggg gccgttggtg attagtgagg acctgaatgg
     4741 gttgactttc ctccgccgaa cagtcacccg tgatccagca ggttggtttg gaaaattgga
     4801 ccaaagctcc atcctcaggc agttgtactg gacaagagga cccaaccatg aagaccccag
     4861 tgagaccatg ataccacacg cacaaagacc tgtgcagctc atggcactac taggagaatc
     4921 ctccctacat ggaccctcat tttatagcaa ggttagcaaa ttagtcatat ctgaacttaa
     4981 agagggagga atggattttt atgtgcccag acaagagtca atgttcagat ggatgaggtt
     5041 ctcagatcta agcacatggg agggcgatcg caatctggct cccagttttg tgaatgaaga
     5101 tggcgtcgaa tgacgccgct ccatctaatg atggtgctgc tggtctcgta ccagagggca
     5161 acaacgagac ccttccccta gaaccagttg cgggcgcagc tatagccgca cccgtcactg
     5221 gccaaaataa cataattgac ccctggatta gaacaaattt tgtgcaagca ccaaatggag
     5281 agttcacagt gtcacccaga aactctcctg gagaaatttt attaaactta gagttgggcc
     5341 ctgacttgaa cccttatttg gctcatttgt caaggatgta caatgggtat gctggtggag
     5401 tggaagttca ggttctcctg gcagggaacg cgttcactgc cggaaagatc ctcttcgccg
     5461 ccgtcccgcc aaatttccca gtggaattct taagcccagc ccagatcaca atgctcccac
     5521 atttaatagt agatgttagg actcttgaac caattatgat cccactccct gatgttagga
     5581 atacattttt ccattatagt aaccagccta atagccgcat gagattagtg gctatgctct
     5641 ataccccact cagatctaat ggttcaggtg atgatgtctt tactgtttct tgcagggttt
     5701 tgactaggcc tactcctgat tttgagttta cttatttagt gccaccttct gttgaatcta
     5761 aaactaagcc tttttcctta cctattttaa ccctttctga gctcacaaat tcgaggttcc
     5821 cagtccccat cgattcgctt ttcaccgccc agaataatgt gttgcaggtg cagtgtcaaa
     5881 atggcaggtg tacacttgat ggtgagttac aaggcacaac ccagttgctc tcatctgaca
     5941 tctgtgcatt cagaggacgg gtgacagcac aaattaacca acgtgacagg tggcacatgc
     6001 aactgcaaaa cctcaatggt acaacatatg acccaactga tgatgtgcca gccccgctgg
     6061 gtacacctga cttcaagggc gtcgtgtttg ggatggtgag ccaaagaaat gtgggtagtg
     6121 atgcgcctgg ctcaaccaga gcccaacagg cgtgggtttc aacctatagc ccccaatttg
     6181 tccccaaatt aggttctgtc aatcttagaa ttagtgacaa tgatgatttc caattccagc
     6241 cgacaaaatt cacaccagtg ggcgtcaatg atgacgatga tggccacccg ttcagacaat
     6301 gggaactacc aaactattca ggggagctta ccttgaatat gaatcttgcc cccccagttg
     6361 ctccaaattt tcctggtgaa caattgttat tcttcagatc tttcgtgcca tgctcaggag
     6421 gttacaacca aggtattata gattgtctta ttccccaaga atggatccaa cacttctatc
     6481 aggaatcagc accctcccag tcagacgtgg ccctaatcag gtatgtcaac cctgatacgg
     6541 ggcgtacact gtttgaagca aaattgcaca gatctggtta cattactgtg gctcactctg
     6601 gagaccatcc tcttgttgtt ccggctaatg gacactttag atttgattct tgggtaaatc
     6661 agttttactc actcgcccca atgggaactg ggaatgggcg aaggagggct cagtaatggc
     6721 tggggctttc attgcaggat tggcaggcga catgctcacg tcatctgtgg gctcccttgt
     6781 gaacgcaggg gcaaacgcca tcaaccaaaa gatagacttt gaaaacaaca aacaactcca
     6841 gtctgcttcc tttcagcatg ataaagagat gctccaagcg caggtgaggg caaccaagca
     6901 gctgcaatct gaaatgatag ccctaaaaca gggggttttg gccgcaggcg gcttttcccc
     6961 cactgatgca gcaaggggat ccattggtgc acccatgaca aaagtgcttg actggtctgg
     7021 cactcgatac tgggcgccca attccacaaa gacaactggc tattcgggac aattcacctc
     7081 ttcacctgtg catatgtcta gcccaaatgc tccacaatca aaacctgcaa agcctaggtc
     7141 tctagctcct tcctcttctt ctagcagtgt ctatagtatg tatactcaat ctactcattt
     7201 aacatctggc tcttctagta atgcttcttc tgcctccaca aaattgacaa atttaagttc
     7261 tggctcctct caaaacagaa cagcagagtg ggtaaatcaa cagagaagtc ttagcccttt
     7321 catgagtggc gcacttaaca tctcacatgt cacgccaccc tcaagtaggg cttccagttc
     7381 tgggacggtc tcgaccgtgc ccaaggaagt tttggactcc tggacgtctg cgtttaacac
     7441 acacagacag ccgctcttcg cacacctcag agtgaggggg gagtcacggt tttagtgaaa
     7501 caagacaatt ggctataatg tgatttcttt ctaaatttgg ctaatttgta tctttt
//