Typing tool

Complete norovirus genomes

KX079488  GII.21
 GII.P21

Length: 7,510 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7465
LOCUS       KX079488                7510 bp    RNA     linear   VRL 08-JUN-2016
DEFINITION  Norovirus GII.21 strain NoV/Kor/JW, complete genome.
ACCESSION   KX079488
VERSION     KX079488.1
KEYWORDS    .
SOURCE      Norovirus GII.21
  ORGANISM  Norovirus GII.21
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7510)
  AUTHORS   Lee,J.W. and Paik,S.-Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-APR-2016) Department of Microbiology, College of
            Medicine, The Catholic University of Korea, 222 Banpo-daero,
            Seocho-gu, Seoul 06591, Korea
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7510
                     /organism="Norovirus GII.21"
                     /mol_type="genomic RNA"
                     /strain="NoV/Kor/JW"
                     /host="Homo sapiens"
                     /db_xref="taxon:1073050"
                     /country="South Korea"
                     /collection_date="01-Apr-2015"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ANI70129.1"
                     /translation="MKMASNDASAAAAANSNNDNAKSSSDGVLSNMAVTFKRALGARS
                     KQPSPRDKPPRPPRPPTPELVKQIPPPPPNGEDEPTISYNVKEGVSGLPELSTVTQPE
                     ESSTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELSPLSLYWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMVQRTTGFFRPYQDWNRKPLPTMDDSKVKKVANVLLCALSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEINELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLAAYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIASSLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDTFKPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPTSTTFNFDRNKVLAFRQLAAENKYGLVDTMRVGSQLKNVKTM
                     TELKQALKNITVKKCQLVYGGSTYTLESDGKGNVCVEKVKNTSVQTNNELSGVLHHLR
                     CARIRYYVKCVQEALYSILQIAGAAFITTRIAKRMNIQNLWSKPQVEDLEETSNREGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLDFEAPPSIWSRIVNFGLGWGFWVSP
                     SLFITSTHVIPKGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEAMLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVGGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQRWTYAQACASLDKTTSSGHPHHMRKNECW
                     NGEAFTGKLADQASKANLMYEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     STMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTVKLK
                     EYGLKPTRPDKTEGPLIISEDLDGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6707
                     /gene="ORF2"
     CDS             5085..6707
                     /gene="ORF2"
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ANI70130.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINTETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRNNFVQAPNGEFTVSPRNSPGEILMNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVDMLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNVFYHFNNQPAPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFTLPILTIGELTNSRFPAPIDQLYTSPNADVVVQPQNGRCTLDGELQGTT
                     QLLTTAICSYRGTTSNPTSDYWDDHLLHLVHPNGATYDPTEDVPAPFGTQDFRGILYG
                     VLTQNTQNPRDEVSNSRGIYISSTSDKFTPKLGTIGLHQVQGDTASNQQSKFTPVGIA
                     VNQNTPFKQWELPNYSGALTLNTNLAPAVGPNFPGEQILFFRSNVPSVQGNHPTQEID
                     CLIPQEWVSHFYQESAPSQSDVALVRYVNPDTGRTIFEAKLHRQGFITIAATGSNPVV
                     VPPNGYFRFDSWVNQFYALAPMGTGNGRRRAQ"
     gene            6707..7465
                     /gene="ORF3"
     CDS             6707..7465
                     /gene="ORF3"
                     /note="VP2"
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="ANI70131.1"
                     /translation="MAGAFIAGLAGDMLTNTVGSLVTAGANAINQKVEYDLTKQLQSA
                     SFQHDKDMLQAQVNATKQLQSDMMAIKAGVLTAGGFSPADAARGAVNAPMTKVLDWSG
                     TRYWAPNSTKTTSQSGQFSFVNVHRPFVQSKTVQPSPPRAPSSSGSVRSLSTQSTMLS
                     NSSFSSLGTPSTQSTNLSSSRTADWVRSQRNLSPYMDGALQTAFVTPPSSRASSTGTV
                     STVPRGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgccaaca gcaacaacga
       61 caacgcaaaa tcttcaagtg acggcgtatt atccaatatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggtccaaac aaccgtcccc gagggacaaa ccaccaagac ccccgagacc
      181 acccacacca gagttggtta aacaaatccc ccctccccca cccaacgggg aggacgagcc
      241 aaccatttct tacaacgtca aagagggtgt ttctggtttg cctgaactct caacggtcac
      301 ccaaccggaa gagagctcta cggcattcag cgttccccct cttagtcaga gggagaacag
      361 agacgcaaag gaacccctaa ctggaaccat cctggagatg tgggacgggg agatctacca
      421 ttatggctta tatgtggaac gaggattagt gctcggtgta cacaaaccac cagcagccat
      481 cagccttgct aaggttgaac tgtccccctt gtctttgtac tggagacctg tgtacacccc
      541 acagtacctc atttcccctg acactctcaa aaagttgcat ggggagacgt tcccttacac
      601 agcctttgac aacaactgtt atgccttctg ctgttgggtt cttgacttga acgattcatg
      661 gctgagcaga aggatggtac agaggacaac gggcttcttt cggccttacc aggactggaa
      721 cagaaaaccc ctccccacaa tggacgactc caaagtgaag aaggtggcca atgttctcct
      781 ctgtgctctc tcatcattgt tcactagacc aattaaggac attattggaa agttaaaacc
      841 cctaaatatc ctcaacatcc tagccacatg tgattggact tttgcaggca tagtagaatc
      901 cctgatcctc ttggctgaac tgtttggagt tttctggaca cccccagatg tgtctgcaat
      961 gatcgctccc ttactgggtg attatgagct acaggggcct gaggacctcg ctgtggaact
     1021 cgtacctgta gtaatgggag ggataggttt ggtgctggga ttcaccaaag agaaaattgg
     1081 caaaatgctt tcatctgctg cttcaaccct gagggcgtgc aaagatctcg gagcttatgg
     1141 gctggagata ctcaaattgg tcatgaagtg gtttttccca aagaaagacg agataaacga
     1201 attggcaatg gtgagatcca tcgaggacgc agtgctggac ctcgaggcca tcgagaacaa
     1261 ccatatgaca gctctactca aggataagga cagccttgca gcctacatga ggactcttga
     1321 cttggaggag gagaaggcga ggaagttgtc caccaagtct gcatcaccgg acatcgtggg
     1381 cacgatcaat gccctactgg caaggattgc agctgcccga tctctagtac acagggctaa
     1441 ggaagaactg tctagcagac ctcgaccggt cgttgtgatg atttcaggga gaccaggtat
     1501 agggaagacc catctagcta gagagttggc aaagaagatt gcctcctcac tcacaggtga
     1561 ccagagggtg ggcctcatcc cacgcaacgg ggtcgaccac tgggatgcat acaaaggtga
     1621 aagagtcgtc ctctgggacg actacggaat gagcaaccct atccacgacg ccctcagact
     1681 ccaggagctt gctgacacct gccccctaac acttaattgt gacaggattg aaaacaaagg
     1741 taaagtcttt gacagtgacg ccataataat aaccaccaat ttggccaacc cagcgccact
     1801 ggattatgtc aactttgaag cttgctcaag acgcatagac ttcctcgtct atgctgatgc
     1861 ccctgaagtt gagaaggcta aacgagactt cccaggccag ccagacatgt ggaaggacac
     1921 cttcaaacct gacttctcac acataaaact gacattagcc ccacaaggag gttttgacaa
     1981 gaacggcaat acccctcatg ggaagggtgt tatgaagacc ctcactgcta gttccctcgt
     2041 tgcccgagca tcagggctcc tccacgagag actagacgag tatgagctgc aaggcccaac
     2101 ttccacaaca ttcaacttcg accgcaacaa ggtgcttgct tttaggcaac tcgctgctga
     2161 gaacaagtac ggtctcgttg atacaatgag ggtcggatca caactcaaga atgtcaaaac
     2221 catgacagaa ctcaaacagg ctctcaagaa catcacagtc aagaaatgcc agcttgtgta
     2281 tggcgggagc acatacacac tcgaatctga tggcaaaggc aatgtgtgtg ttgagaaggt
     2341 gaagaacaca agtgtgcaga ctaacaacga gctctccggc gttctgcacc atctcaggtg
     2401 tgccaggatt aggtactatg ttaagtgtgt ccaggaagct ctctactcca tcttgcaaat
     2461 tgccggggct gcattcatca ccacgcgcat tgcaaagcgc atgaacatac aaaacctatg
     2521 gtccaaacca caagtggaag atttggagga gactagcaac agggagggct gtccaaaacc
     2581 taaagatgat gaggaatttg ttatctcctc tgatgacatc aaaaccgagg gcaagaaagg
     2641 aaagaacaag actggccgtg gcaagaagca cacagccttt tccagcaaag gtctcagtga
     2701 tgaggagtac gatgagtaca agagaatcag agaagagaga aatggcaagt actccataga
     2761 ggaataccta caggacagag acaagtacta tgaggaggtg gccatagcca gggcaactga
     2821 ggaagatttc tgtgaggaag aggaggccaa aatccggcaa aggatattta gaccaacaag
     2881 aaagcaacgc aaagaggaaa gggcctctct tggtttggtc acaggttctg agattaggaa
     2941 gagaaatcca gatgacttca aacctaaagg gaagctatgg gctgatgatg acaggagtgt
     3001 tgactacaat gagaaacttg acttcgaggc tccaccaagc atttggtcac gaatagttaa
     3061 ctttggttta gggtggggct tctgggtctc gcctagcctc ttcataacat caacccacgt
     3121 cattcccaaa ggtgcacagg agttctttgg agtgcctatc aagcaaatac aaattcataa
     3181 atcaggagag ttctgccggc taagatttcc aaaaccaatc aggacagatg tcacgggcat
     3241 gatcttagag gaaggtgctc cagaaggaac tgttgccaca cttctcatca agagaccaac
     3301 tggggaactc atgcccttgg cagccagaat gggtacccac gcgaccatga aaatccaggg
     3361 tcgcactgtt ggtgggcaga tgggcatgct actcacgggg tctaacgcca agagtatgga
     3421 tttgggcaca actcctggtg actgtggctg tccctacatc tacaagaggg ggaacgacta
     3481 cgtggtcatt ggagtccaca ccgccgctgc ccgtggagga aacactgtca tctgtgcaac
     3541 ccaaggaagt gagggtgaag ccatgctaga gggtggcgac aataagggaa cctactgtgg
     3601 agcaccaata ttaggccctg gaaatgcccc taaactcagt accaaaacca aattctggag
     3661 gtcttctacc acccccctgc cacccggaac ctatgaacca gcttatctgg gtggcaagga
     3721 ccccagagtg gggggtggtc cctcactgca acaggttatg agggagcaac taaaaccatt
     3781 cactgagccc agaggcaaac caccaaaacc tagtgtgcta gaagctgcca agaagactat
     3841 aatcaatgtg cttgaacaga caatagaccc acctcaaaga tggacatacg cacaggcgtg
     3901 tgcatcacta gataagacca cttccagcgg ccaccctcac cacatgcgga agaacgagtg
     3961 ctggaacgga gaggctttca caggaaaatt ggcagaccaa gcatcaaaag ctaatttaat
     4021 gtatgaggaa ggaaagaaca tgaccccagt atacacagga gctctgaagg acgaactagt
     4081 caagactgat aagatctatg ggaagatcaa aaagagactc ctatggggtt cagacctatc
     4141 aaccatgata cggtgtgcac gagctttcgg tgggctgatg gacgagctca aggcccattg
     4201 cgtcacacta ccagttaggg ttggcatgaa catgaatgag gatggaccca taatatttga
     4261 gaaacattcc agatacagat accattatga tgcagattac tctcgctggg actcgacaca
     4321 gcaaagagca gtgctggctg cagccctgga aataatggtc aaattttcac cagaacctca
     4381 tctggcccaa gtagttgcag aagacctctt gtcccccagt gtgatggatg tgggtgattt
     4441 caagatttca atcaacgagg ggttaccctc tggtgtgcct tgcacctcac aatggaactc
     4501 cattgctcac tggctcctca cactgtgtgc actgtctgaa gttacagatc tgtcccctga
     4561 catcatccag gcaaactccc tattctcctt ttatggtgat gatgaaatag tgagcacaga
     4621 catcaaattg gacccagaga aactgacagt aaagttgaag gaatacgggt taaaaccaac
     4681 ccgtcctgat aaaacagaag gacccttaat tatctctgaa gatttggatg gcctgacctt
     4741 cttacggaga acggtgactc gcgatccggc tgggtggttt ggcaaactgg accaaagttc
     4801 aatactcagg caaatgtact ggaccagggg accaaaccat gaggacccct ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaact gatgtcacta ctaggtgaag ctgcactaca
     4921 tggcccatca ttctatagta aaatcagcaa gttggtcatc tcagaattga aagagggtgg
     4981 gatggacttt tacgtgccca gacaagaacc aatgtttagg tggatgagat tctcagattt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctaat gatggtgctg caggtctcgt accagagatc aacactgaga
     5161 ccttgcccct cgagcccgtg gccggagcgg caattgctgc ccctgttacg ggccaaaata
     5221 atataattga tccctggatt agaaacaatt ttgtgcaggc ccctaatggt gagtttacag
     5281 tctcccctag aaattcccct ggtgaaattt taatgaattt ggagctaggg ccagatctta
     5341 atccatattt ggctcacctt tcaagaatgt acaatggtta tgctggagga gtggaagtgc
     5401 aagtgctcct agctgggaat gcgttcacgg caggaaagat cctttttgca gcagtccccc
     5461 caaatttccc cgttgatatg cttagtcctg ctcaaatcac aatgcttccc catttaattg
     5521 tagatgtcag aactttggag cccattatga tccctctgcc tgatgttagg aacgttttct
     5581 atcactttaa taaccagcct gccccaagaa tgagattggt tgctatgctc tacactcctt
     5641 taagatccaa tgggtccggt gatgatgtat tcactgtctc ctgcagggtg ctaaccagac
     5701 ctactccgga ctttgagttt acatatttag ttcccccctc ggtagagtct aaaaccaagc
     5761 ctttcaccct acccatccta acaattggag agttgacaaa ttctagattc ccagccccga
     5821 tcgatcagtt gtacacttca cccaacgctg atgtagttgt ccaaccccaa aatggccggt
     5881 gcacactgga cggtgagcta caaggcacaa cacaacttct gacaacggca atatgttcat
     5941 acaggggcac aacatcaaac cccactagtg actactggga tgatcacctc ctgcacttgg
     6001 tccaccccaa tggggcaaca tatgacccga ccgaggacgt gccagctcct tttggcacgc
     6061 aggactttcg gggcattctg tatggggtgt tgactcaaaa cacccaaaat cccagggacg
     6121 aagtctccaa ctcccgtggg atctacatct catccactag tgacaagttc actccaaaat
     6181 tgggtacaat tggcttacac caagtgcaag gcgacacagc cagcaaccaa caatcaaaat
     6241 tcacaccagt agggatagcg gtgaatcaaa acactccttt caaacagtgg gaactcccaa
     6301 actactctgg tgccctcacc ctcaacacaa accttgcacc agcggttggg cccaacttcc
     6361 ctggggagca aatccttttc ttcaggtcaa atgtcccaag tgttcaaggt aaccacccta
     6421 ctcaagagat tgattgcctg atcccacaag aatgggtttc ccacttctat caagaatcag
     6481 ctccctctca gagtgatgtg gctttggtca ggtatgtcaa tcctgacaca gggcgcacaa
     6541 tctttgaggc caaactgcat aggcagggat ttatcaccat agcggccact ggaagcaacc
     6601 ccgtggtcgt gccccccaat gggtacttca gatttgattc ctgggtcaac cagttttatg
     6661 cactcgcccc catgggaact gggaatgggc gcagaagagc tcaataatgg ctggagcttt
     6721 tatagcagga ttggcaggtg acatgctcac caatactgtt ggttccctgg taacagcggg
     6781 ggctaatgct ataaaccaaa aagttgaata tgacctcacc aaacaactgc aaagtgcctc
     6841 cttccaacat gacaaggaca tgcttcaagc ccaggtcaac gcaacaaaac aattgcagag
     6901 tgacatgatg gccatcaaag caggggtttt gaccgctggc ggcttttccc ctgctgatgc
     6961 agccagaggg gcagtcaatg ctccaatgac aaaagtctta gactggtcag ggacgcgtta
     7021 ctgggcaccc aattcaacca aaacaacaag ccaatctggt cagttctcct ttgtaaatgt
     7081 gcatagaccc tttgttcaat caaaaactgt ccaaccatct cctccgcggg cgccctcatc
     7141 ttcgggtagc gttcgcagcc tttctactca atcaacaatg ctttcaaatt ctagcttttc
     7201 ttcccttggg actccttcaa ctcagtcaac aaatctttct tcttctcgaa cggcggactg
     7261 ggttcgaagt cagaggaacc tgagccccta catggacggg gctctgcaga cagcctttgt
     7321 caccccacca tcaagcagag cttcttctac aggcaccgtc tcaacagtgc ctagaggggt
     7381 tttggactcc tggacacctg cgttcaacac ccgcaggcag ccgcttttcg cacacctcag
     7441 gaagaggggg gagtcacaag cctagtgaaa agaatcactt taataaattc ttttaaaaaa
     7501 aaaaaaaaaa
//