Typing tool

Complete norovirus genomes

KU935739  GII.6
 GII.P7

Length: 7,581 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6722
ORF3: 6722..7498
LOCUS       KU935739                7581 bp    RNA     linear   VRL 31-OCT-2016
DEFINITION  Norovirus GII isolate 0907-26, complete genome.
ACCESSION   KU935739
VERSION     KU935739.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7581)
  AUTHORS   Huo,Y.
  TITLE     Characterization of major capsid protein of a GII.6 norovirus
            isolated in China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7581)
  AUTHORS   Huo,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-MAR-2016) Center for Translational Medicine, The
            Sixth People's Hospital of Zhengzhou, No. 28 Jingguang Rd,
            Zhengzhou, Henan 450000, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7581
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="0907-26"
                     /isolation_source="feces"
                     /db_xref="taxon:122929"
                     /country="China"
                     /collection_date="07-Sep-2015"
                     /note="genotype: GII.6"
     gene            5..5098
                     /gene="POL"
     CDS             5..5098
                     /gene="POL"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AOY41703.1"
                     /translation="MKMASNDATTAFGSQNSVNDSINTAPSNKEEVGAFSNIKVGFKK
                     MLGAVPKGTKAPSSDQHCPSVKIGTKTLTVPPEPPNGEDTVQFDAKSETVRGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPATEPLPGTILEMWDGEFYHYSVYVSGGKALGVHKPP
                     AAISLATIELTPISLYWRPVYTPNYLVCPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLSRRSISRTTGFFKPYQSWNRKPLPTVDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFGIFWTPPDVSSFIASLIGDFELQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRVDFLVYAESP
                     EIEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGTALKS
                     VKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDKVEDQTSQTANEVGAAL
                     LRLRQARARYYVSCFQDLVYTLMQVAGASFVVNRISKRFCWERWVKPTETQETSESEK
                     EVAQGRWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEFKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTKKQRKEERGVLGLVTG
                     SDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGINELFGVEIKQIQIHKSGEFCRFRFPRPIRPDVTGLVLEEGAPEGTV
                     CSILVKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNENLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPAVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHVRKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHVQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MIRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPMKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVINEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     gene            5079..6722
                     /gene="VP1"
     CDS             5079..6722
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="AOY41704.1"
                     /translation="MKMASNDAAPSNDGAANLVPEATNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVENISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQENTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAPIDMLYTDPNEAIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICSFRGTLISQTSRSADSTDSAPRARNHPLHVQLKNLDGTPYDPTDEVPAVLG
                     AIDFKGTVFGVASQRNTTGNSIGATRAHEVHIDTTNPRYTPKLGSVLMYSESNDFDDG
                     QPTRFTPIGMGADDWHQWELPEYSGHLTLNMNLAPAVAPAFPGERILFFRSVVPSAGG
                     YGSGHIDCLIPQEWVQHFYQEAAPSQSAVALIRYVNPDTGRNIFEAKLHREGFITVAN
                     SGNNPIVVPPNGYFRFEAWVNQFYTLTPMGTGQGRRRVQ"
     gene            6722..7498
                     /gene="VP2"
     CDS             6722..7498
                     /gene="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AOY41705.1"
                     /translation="MAGAFLAGLAGDAITNGVGSLINAGANAINQKVEYDFNKQLQLA
                     SFKHDKEMLQSQVLATKQLQQEMMNIRQGVLSAGGFSPTDAARGAVNAPMTKILDWNG
                     TRYFAPNSMKTTSYSGQFSSNPVHRQPTLPRSESPKIKVNSDSASVYSSASTAPSQST
                     HSTALTAGSSSSRTTSSSAVASTLSRTSDWVRGQNERLSPFMDGALHTTFVTPPSSKA
                     SSYGSVSTVPKAVLDSWTPMFNTHRQPLFAHVRRRGESQI"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cactgccttt ggcagccaaa actctgtcaa
       61 tgacagtatc aacaccgccc cttctaataa agaagaggtt ggtgcattct ccaacatcaa
      121 agttggtttt aagaaaatgc tgggtgccgt tcccaagggg accaaagcac ccagtagtga
      181 tcagcactgc ccctcagtta agatcgggac caagacatta acagttcccc ctgagccccc
      241 aaatggtgaa gacaccgtgc agtttgatgc gaagtcggaa actgtgcgcg ggttaccaga
      301 cttgacaacg gtgcagaatg aacacgaaaa cacaccatac actgtccccc cgttgagtga
      361 aagggagcac agaccagcta ctgaaccgct tcctggcaca atactggaga tgtgggatgg
      421 tgaattctac cattactctg tgtacgtcag cggtggcaaa gccctagggg ttcacaagcc
      481 ccctgcagcg ataagcctcg cgacgataga gctcacaccc atatctcttt attggaggcc
      541 cgtttacacc cccaactatc tggtctgccc agacacgttg aagggccttg ctggtgagaa
      601 gttcccctac acggccttca gcaacaactg ttacaacttc tgttgctggg tgcttgagct
      661 caatgacacg tggcttagca ggagaagcat ctctaggacc accggcttct ttaaaccata
      721 ccagtcttgg aataggaaac cccttccaac cgttgatgat ggaaagatca aaaaggtggc
      781 caacgcaatt ctctgtgcac ttggatcact gttttcaaaa ccaattaagg acctattggg
      841 caaacttaaa ccattgaact tgctgcactt gctcgcatca tgtgactgga cttttgcggg
      901 tatagtagag acagtcatcc taatggcgga acttttcggc atcttttgga caccgccaga
      961 tgtttccagt ttcatagctt ccctgatagg tgattttgaa ttgcaagggc ctgaggacct
     1021 ggctgtggag cttgtacccg tggttatggg tggcatagga atggttctcg gcttcactgc
     1081 tgagaagata ggccgcatgc tatcgtccgc tgcatcaaca ctacgggcgt gcaaagactt
     1141 ggggaattat gctcttgaca tattgaaact ggttatgaag tggttcttcc caaagaaaga
     1201 agagaaagcc gagatggaaa ccctaagggc gattgaggat gccgtcctgg acatggaagc
     1261 tataggaaat aaccatctca caaccctcct caaggacaag gatagcctca cggctttcat
     1321 gaagacttta gatctagaag aagagaaggc aaggaaactg tccaccaaat catcctcgcc
     1381 agacattgtc ggcaccatta atgccatact agctagaata gctgctgcca ggtccctctt
     1441 gcacaaggct aaagaagaaa tgttcagcag gatcagaccc gtggttgtca tgatctcggg
     1501 tagacctggc attggcaaaa cccacatggc aagacacttg gctaagagta tcgccaacac
     1561 catgagcggc gaccagagag tggggctcgt cccacgcaac ggggttgatc attgggacgc
     1621 ctacagggga gagagggtgg ttttatggga tgattatggc atgggaaacc ctgtcaaaga
     1681 tgccctaaca ctgcaagagc tggccgacac ctgcccagta actctaaact gtgataggat
     1741 tgagaacaag gggaagatgt ttgacagtga tgtcatcata atcacgacca atttagtcaa
     1801 cccagcgccc ctcgattatg taaacttcga ggcgtgctcc agaagggtcg acttcctggt
     1861 ctatgcagag tcaccagaaa ttgagaaggt taagagagac ttccctggcc aacctgacat
     1921 gtggaaggac cattttaagc cagacttttc ccacataaaa ctgactctag ccccacaggg
     1981 tggatttgac aagaatggca acaccccgca tggtaagggc accatgcgat ccctaaccca
     2041 ggggtccctg actgcaaggg ttgcaggtct tgttcatgag aggagagacg agtttcagct
     2101 ccaggggaat gaccttcaaa catataactt tgacaccaac agagtctctg catttaggaa
     2161 gctggccgca gacaacaagt atgggatcat ggagactatg agagtgggca cagcgcttaa
     2221 gagtgtcaag accttggaag atctgaaagt tgcactgagg gatgtgaagt tcaatgagtg
     2281 tgagataatt tacagaaact ccaagtaccg agtctcttcc aatggtaaag gttctgtctc
     2341 tgttgacaaa gttgaggacc aaacatccca gaccgcaaac gaagtgggtg cagcactcct
     2401 tagactcaga caggcaagag ccagatacta tgtcagctgc ttccaagacc tcgtttacac
     2461 tctaatgcag gtcgccggag catcattcgt cgtcaacagg atctctaaaa ggttctgctg
     2521 ggagagatgg gtcaaaccaa ccgagaccca ggaaacgagt gaatccgaaa aggaagtggc
     2581 ccaaggcaga tgggagattg agcccaagga cacagaacca gaaggtaaga agggtaagaa
     2641 caagaaggga agaggcaaga aacacacagc tttctccagt aaaggcctga gtgatgagga
     2701 gtatgacgag ttcaagagaa tcagagaaga aaggaacgga aaatactcca ttgaggaata
     2761 cctgcaagac cgggatcgct actatgagga ggtggcagtc gcccgggcga cagaggagga
     2821 cttctgtgaa gaggaggagg ccaagataag acaaagaatc tttcgcccca caaagaagca
     2881 gaggaaggaa gaaagggggg tgcttggttt ggttactggc tcagacatca ggaagagaag
     2941 accagacgat tttcaaccga agggcaacct gtgggcagac gacaccagga gtgtggacta
     3001 caacgagaga cttgatttcg aggctccccc gagtgtctgg tcaagaatag tcccattggg
     3061 cactggctgg ggtttctggg tctcatcaaa cctcctgatc acaacaacgc acgtcctacc
     3121 taaggggatt aatgaactct ttggagttga gatcaaacag attcagattc ataagtctgg
     3181 agagttctgc aggtttagat tcccaagacc aattagacca gatgtcacag ggctcgtgtt
     3241 ggaggaaggc gctccagaag gcactgtctg ctccatactc gtaaagagac ctacaggtga
     3301 gatgatcccc ctggcagtga ggatgggcac acatgcatcc atgaaaatac agggtaggac
     3361 cgtcggtggc cagatgggaa tgctcctcac aggggcaaat gcgaagaaca tggatcttgg
     3421 caccggtcct ggtgactgcg gttgccctta catctacaaa cgtggcaatg atatagttgt
     3481 cgcgggtgtc cacaccgcag cagcccgggg aggcaacact gtcatatgtg ccactcaagg
     3541 gcaagatggg gaagcagtcc ttgagggaaa tgagaacctt ggcacttact gcggtgctcc
     3601 aatcttgggt ccaggcaagg cgcccaaact tagcacgaag accaagttct ggcgttcatc
     3661 accagacgct ttgccgccag gcacttacga gcctgcctac ttgggaggta aggaccctag
     3721 agtggaaaaa ggaccatccc tgcagcaagt catgagggac cagctaaaac ctttcacaga
     3781 acccaggggc aagccaccta gacctgcagt cttagaagaa gccaaaaaga cagtgatgaa
     3841 tgttctagag caaaccattg accctgctaa accgtggacc tattcccaag catgcgcctc
     3901 actggacaag accacttcca gtggcagccc ccatcatgtc aggaaaaatg accattggaa
     3961 tggggaatcc ttcactggcc ccctcgcaga ccaagcatcc aaagccaacc tcatgtacga
     4021 gcaggccaaa catgtgcagc ccgtgtacac ggccgcactt aaagatgaac tagtcaaaac
     4081 tgataagatc tacaagaaga taaagaaaag gctcttgtgg gggtcggatc ttggcacaat
     4141 gatcaggtgt gccagggcct ttggcggtct catggatagc atgaaggcaa gctgcatagc
     4201 cctcccatgt agggtaggaa tgaacatgaa tgaagatggc cccatcatat ttgacaagca
     4261 ttctaagtat aggtaccatt atgatgctga ctattccagg tgggactcaa cccagcaaag
     4321 gagcattctc tcggccgcta tggaagtgat ggtgcggttc tctgctgaac cagagctggc
     4381 acaagtggtt gcagaggacc tcctggcacc cagccaacta gatgttggcg atttcgtcat
     4441 ctcagtccag gagggtctgc catcaggggt cccatgcaca tcacaatgga attcaatagc
     4501 acactggatc ctaaccttga gtgcaatggc agaagtgtcg ggtctctcac cagatgttgt
     4561 tcaagcccac tcctgtttct cattctacgg tgatgatgag atcgtcagca ctgatatcaa
     4621 ccttgatccc atgaagttga cacaaaagct cagagagtat ggcctggtcc ccacccgacc
     4681 tgacaaaact gagggtcccc tcgtaataac tgaagatctc accggcctaa cgttcctgcg
     4741 taggtcaatt gcacgggacc cagctgggtg gtttggaaaa ttggaccaag actcaatcct
     4801 cagacagttg tactggacaa ggggccccaa ccatgagaac ccatatgaga gcatggtccc
     4861 tcattcccag cgggccacac aacttatggc ccttctcggt gaggcttcac tacatggtcc
     4921 ccagttttac aagaaagtta gcaagatggt tattaatgag atcaaaagtg gtggtctgga
     4981 attctatgtg cccagacaag aggccatgtt cagatggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga gggtgtgaat gaagatggcg tcgaatgacg
     5101 ctgctccatc gaatgatggt gctgccaacc tcgtaccaga ggccaccaat gaggttatgg
     5161 cacttgagcc ggtggtggga gcctcaattg ctgctcctgt cgtcggccaa caaaatataa
     5221 ttgacccctg gattagagaa aattttgttc aggcaccaca gggtgagttt actgtttcac
     5281 caaggaactc acctggtgag atgcttctaa atcttgaatt aggccctgag ctcaaccctt
     5341 atctgagtca tttgtcccgc atgtataacg gctatgctgg tggtatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggta aaatcatctt tgccgccgtc ccaccacatt
     5461 tccctgttga gaacattagt gcagcccaaa tcacaatgtg cccccatgtg attgttgatg
     5521 taagacagct tgagccagtg cttttgcccc ttcctgacat aaggaataga ttctttcatt
     5581 ataatcagga aaataccccc cggatgagac ttgtggctat gttgtacaca ccccttagag
     5641 caaattctgg tgaggatgtg tttactgtgt cttgcagagt tctgacccgc cctgcccctg
     5701 actttgagtt cacgtttttg gtgccaccaa ctgtggagtc aaagactaag ccctttacac
     5761 tccctattct gactcttgga gagctgtcca actccagatt ccccgctccg atagacatgt
     5821 tgtacactga ccccaatgaa gcaattgtgg tgcaaccaca aaatggcagg tgcacactag
     5881 atggaacact tcaggggacc acccaactgg tacccaccca aatttgctcc ttcaggggca
     5941 cgctaattag ccagacgtcg aggtctgcag attcaacaga ttcagcccca cgggcgagga
     6001 accaccctct ccacgttcag ctgaagaacc tcgatgggac accatatgac ccaacagatg
     6061 aggtgccagc agttttaggc gccatagatt tcaaaggaac tgtttttgga gtcgctagcc
     6121 aaaggaacac cacagggaac tctataggag caacccgcgc ccatgaagtg cacatagaca
     6181 ccacaaaccc tagatacacc ccaaagcttg gctctgtgtt gatgtattct gaatctaatg
     6241 attttgatga tggacaaccc acccgcttca cccccatcgg catgggagcc gatgattggc
     6301 accaatggga attgcccgaa tattctggtc acctcactct taacatgaat ttggcccccg
     6361 cagttgcccc tgctttccct ggtgagcgca ttctcttctt cagatcagtg gtgccgtctg
     6421 ctggtggcta tggatcaggt cacatagatt gcctcatccc acaggagtgg gttcagcatt
     6481 tctaccagga ggccgcccca tcacagtccg cggtggctct tatcagatat gtcaaccctg
     6541 acactggaag aaacatcttt gaggcaaaac tgcatagaga agggttcatc actgtggcaa
     6601 attctggaaa caaccccata gttgtgcccc caaatggtta cttcaggttt gaggcctggg
     6661 ttaatcaatt ctacacactc acccccatgg gaactggaca ggggcgcaga agagttcaat
     6721 aatggcagga gctttcttag ctggattggc aggtgacgcc ataacaaatg gtgtcgggtc
     6781 cctaatcaat gctggggcca atgcaattaa ccaaaaggtg gaatatgact tcaataagca
     6841 gctccaattg gcatccttca aacatgacaa agagatgttg caatcacaag tactggccac
     6901 taaacagctc cagcaggaga tgatgaacat aaggcaaggg gtcttgtccg ctggcggctt
     6961 ttcccctaca gatgccgcga ggggtgctgt gaacgcgccg atgacaaaaa ttttggattg
     7021 gaatgggaca aggtactttg ccccaaatag tatgaagaca accagttatt cgggccagtt
     7081 ttccagcaac cctgtgcata ggcaacccac tttaccccgc tctgaatccc caaaaatcaa
     7141 ggttaatagt gattctgcta gtgtgtatag ttctgcatct actgctcctt cacaatcaac
     7201 tcactcaacg gctttgactg cggggtctag ctcatctagg acaacatcct cttctgcagt
     7261 agcttctacc ctatctagga ctagtgattg ggtgagagga caaaatgaaa ggcttagccc
     7321 gtttatggat ggtgccctcc acacaacttt tgtcacacca ccatcgagca aggcttcatc
     7381 atatgggtcg gtctcaaccg ttcccaaagc tgttttggac tcctggactc ctatgttcaa
     7441 cacccatagg cagcctctct tcgctcatgt gcgcaggcga ggggagtcac agatttagtg
     7501 aaaagattga ttaggttttc tttctttctt cttttccttt tctttctttt aaaaaaaaaa
     7561 aaaaaaaaaa aaaaaaaaaa a
//