Typing tool

Complete norovirus genomes

KU870455  GII.6
 GII.P7

Length: 7,563 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6731
ORF3: 6731..7510
LOCUS       KU870455                7563 bp    RNA     linear   VRL 12-OCT-2016
DEFINITION  Norovirus GII.6 isolate NHBGR59, complete genome.
ACCESSION   KU870455
VERSION     KU870455.1
KEYWORDS    .
SOURCE      Norovirus GII.6
  ORGANISM  Norovirus GII.6
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7563)
  AUTHORS   Ao,Y.
  TITLE     The complete sequence analysis of norovirus strain NHBGR59
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7563)
  AUTHORS   Ao,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2016) Viral Diarrhea, Institute for Viral Disease
            Control and Prevention, China CDC, No. 100 Ying-Xin Street, Xuan-Wu
            District, Beijing 100052, China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: DNAStar v. 3.2
            Sequencing Technology :: 454; Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7563
                     /organism="Norovirus GII.6"
                     /mol_type="genomic RNA"
                     /isolate="NHBGR59"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:499193"
                     /country="China"
                     /collected_by="Ao Yuanyun"
                     /note="genotype: GII.6"
     5'UTR           1..4
     CDS             5..5098
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AOV81582.1"
                     /translation="MKMASNDATAALGSQNSVNDSINTTPSNKEEAGAFSNIKVGFKK
                     MLGAVPKGTKAPSSDQHCPTVKIGPKTLTVPPEPPNGEDTVQFDAKSETVIGIPDLTT
                     VQNEHENTPYTVPPLSEREHRPATEPLPGTILEMWDGEFYHYSVYVSGGKALGVHKPP
                     AAISLATIELTPISLYWRPVYTPNYLVCPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLSRRSISRTTGFFKPYQSWNRKPLPTVDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNVFWTPPDVSNFIASLIGDFELQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKNIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRIDFLVYAESP
                     EIEKVKRDFPGQPDMWKDYFKQDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERKDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGAALKN
                     VKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDKVEDHTSQTANEVGSAL
                     LRLRQARARYYVSCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPTETQEASEPEK
                     EVAQGRWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEFKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTRKQRKEERGVLGLVTG
                     SDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGVKELFGVEVKQIQIHKSGEFCRFRFPRPIRPDVTGLVLEEGAPEGTV
                     CSILVKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNEDLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPAVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHVRKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHVQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MIRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPMKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVINEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPESVNEDGVE"
     CDS             5079..6731
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="AOV81583.1"
                     /translation="MKMASNDAAPSNDGAANLVPEANNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVDNISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQEDTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAAIDMLYTDPNESIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICAFRGTLISQNARAADLTDSPQRARDHPLHVQVKNLDGTQYDPTDDIPAVLG
                     AIDFKGTVFGVASQRDVSGTQEQGHYATRAHEAHIDTTDPKYAPKLGTILIKSESTDF
                     TTNQPIRFTPVGMGDNNWRQWELPDYSGSLTLNMNLAPAVSPSFPGERILFFRSIVPS
                     AGGYGSGYIDCLIPQEWVQHFYQEAAPSQSAVALVRYVNPDTGRNIFEAKLHREGFLT
                     VANSGNNPIVVPPNGYFRFEAWVNQFYTLAPMGSGQGRRRAQ"
     CDS             6731..7510
                     /note="VP2"
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="AOV81584.1"
                     /translation="MAGAFFAGLAGDVVSNGIGSLINAGANAVNQKVEYDFNKQLQMA
                     SFKHDKEMLQSQVLATKQLQQEMMNIKQGMLTAGGFSPADAARGAVNAPMTKILDWSG
                     TRYWAPNSMKTTSYSGQFSSSPVHRSPAPLQHTAPPKSKLQSDSASVYSSPSTVSSQL
                     THSTVLSAGTGSSRSTPTSTATSTLSRTSDWVRGQNERLGPFMDGALQTTFVTPPSSK
                     ASSDGTVSTVPKAVLDSWTPMFNTHRQPLFAHLRRRGESQI"
     3'UTR           7511..7563
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgctgccctt ggcagtcaaa actctgtcaa
       61 tgacagtatc aacaccaccc cttcaaacaa agaagaggct ggtgcattct ccaacatcaa
      121 agttggattt aagaaaatgc tgggtgccgt acctaagggc actaaagcac ccagcagtga
      181 ccagcactgt ccaacagtta agatcgggcc caaaacacta acagtccccc ctgaaccccc
      241 aaatggtgaa gacactgtac agtttgatgc aaaatcggaa actgtaattg ggataccgga
      301 tttgacaaca gtgcaaaatg aacatgaaaa taccccatac actgtccctc cactgagtga
      361 gagggaacac agaccagcca ctgagccact tcctggcaca atattggaga tgtgggatgg
      421 tgaattttac cactactccg tgtacgtcag cggcggcaaa gctctggggg ttcacaaacc
      481 tccggcagct ataagtctcg cgacgataga gctcaccccc atatctctat actggaggcc
      541 cgtttacacc cccaactatc tggtctgccc agacacactg aaaggtctcg ctggtgaaaa
      601 gttcccctac acggccttca gcaacaattg ctacaacttc tgttgctggg tgcttgaact
      661 caatgacacg tggcttagca gaagaagcat ttctagaacc accggcttct tcaaaccgta
      721 ccagtcttgg aacaggaaac ctctcccaac cgttgatgat ggaaagatca aaaaggtggc
      781 caacgcgatc ctttgtgcac tcggttcgct gttctcaaaa ccaatcaagg acctgctagg
      841 caagctcaaa ccattgaact tactacacct gctagcgtcg tgtgattgga cgtttgcagg
      901 tatagtggag acagtcatct taatggcaga actcttcaac gtcttttgga ccccgccaga
      961 cgtctcaaat tttatagcct ccctgatagg tgattttgaa ttgcaggggc ctgaggactt
     1021 ggcggtagag cttgttcctg tggttatggg tggtatagga atggttctcg gcttcacagc
     1081 tgagaagata ggtcgcatgc tgtcgtccgc tgcatcaaca ctgcgggcgt gtaaagactt
     1141 agggaactat gcccttgaca tacttaaatt ggtcatgaaa tggttcttcc caaagaaaga
     1201 ggagaaagcc gagatggaaa ccttaagggc gattgaggat gccgtcctag atatggaggc
     1261 cataggtaac aaccacctca cgaccctcct caaggataaa gacagtctca cggccttcat
     1321 gaagaccttg gatctggaag aagagaaagc aaggaagcta tccaccaaat catcctcacc
     1381 ggacatcgtc ggcactatca atgccatact ggctaggata gctgccgcta gatccctcct
     1441 gcacaaagcc aaagaagaaa tgttcagcag gatcagacca gtggttgtta tgatctcagg
     1501 cagacctggc attggcaaaa ctcatatggc gagacatctg gctaaaaaca tcgccaacac
     1561 catgagtggt gaccaaagag tcgggctcgt tccgcgcaac ggggttgacc actgggacgc
     1621 ttacagagga gagagggtgg tcttgtggga tgattatgga atggggaacc ctgtcaaaga
     1681 tgctttaaca ctacaagagc tagctgacac atgcccagtc actctaaact gtgacaggat
     1741 cgagaacaag ggaaaaatgt tcgacagtga tgtcatcata atcacgacca acctagtcaa
     1801 ccctgcacct ctcgattatg tgaacttcga ggcgtgctct agaaggattg atttcttggt
     1861 ctatgcagag tcaccagaaa ttgagaaggt taagagagat ttccctggcc aacctgacat
     1921 gtggaaagac tatttcaaac aagacttttc ccatataaag ctaaccctag ccccccaagg
     1981 cggatttgac aagaatggta acaccccgca tggtaagggc accatgcgat ccctcaccca
     2041 ggggtccctg accgcaaggg ttgcaggcct tgttcatgag agaaaggatg agttccagct
     2101 acaagggaac gacctccaga catacaactt tgacaccaac agggtctctg cgttcaggaa
     2161 actggctgca gacaacaagt atggaatcat ggaaacaatg agagtgggtg cagcgctcaa
     2221 aaatgtcaaa actttggaag atctgaaggt cgccttgaga gatgtaaagt ttaatgagtg
     2281 tgaaataatt tacaggaact ctaagtaccg ggtctcttcc aacggcaagg gctctgtttc
     2341 tgttgacaaa gttgaggacc acacgtctca gactgcaaat gaagtgggct cagcactcct
     2401 cagacttagg caagcaaggg ctagatatta tgtcagctgc ttccaagacc tcgtctacac
     2461 tctcatacag gttgctgggg catcattcgt tgtcaacagg atctctaaaa ggttctgctg
     2521 ggaaaggtgg gtaaaaccaa ccgaaaccca agaagcgagt gagcccgaaa aggaagtagc
     2581 tcaaggtaga tgggagatag agcccaagga cacagaacca gaaggcaaga agggtaagaa
     2641 caagaaaggg agaggcaaga aacacacagc cttctccagc aaaggcctaa gtgatgaaga
     2701 gtatgatgag ttcaagagaa tcagggaaga gaggaacgga aaatattcca ttgaggaata
     2761 cctgcaagac cgggaccgct actatgaaga agtggcagtt gcccgagcaa cagaagagga
     2821 cttttgtgaa gaagaagaag ccaaaataag acaaagaatc ttccgcccga caaggaagca
     2881 aagaaaagag gaaagggggg tacttggctt agtcactggt tcagatatca ggaagaggag
     2941 accagacgat tttcaaccaa aaggcaacct gtgggcagat gacactagga gtgtggacta
     3001 caatgagaga cttgactttg aggctccacc aagcgtctgg tcaagaatag tcccattggg
     3061 cactggttgg ggcttctggg tttcatcaaa cctcctgatc acaacaacac acgtcctgcc
     3121 caagggggtc aaggaactct ttggggtcga agtcaaacaa attcaaatcc acaagtctgg
     3181 ggagttctgc aggtttaggt tcccaagacc aatcaggcca gatgtcacag gactcgtgtt
     3241 ggaggaaggt gctcctgaag gtactgtctg ttctatactt gttaagaggc ctacaggtga
     3301 gatgatcccc ctagcagtga ggatgggcac gcatgcgtcc atgaaaatac agggtaggac
     3361 cgtcggtggc cagatgggaa tgcttctcac aggggcaaat gcaaagaaca tggatcttgg
     3421 caccggtcct ggcgactgcg gttgtcctta catctataag cgtggcaacg acatagttgt
     3481 cgcgggtgtc cacaccgcag cagcccgggg gggcaacact gtcatttgtg ccactcaagg
     3541 acaagacgga gaggcagtcc tcgagggaaa tgaagacctc ggtacctact gtggtgctcc
     3601 aattctgggc cctggtaaag cgcctaaact cagcacaaaa actaaatttt ggcgctcatc
     3661 accagatgcc ctacctcctg gtacgtatga gcctgcttat ctggggggta aggatcccag
     3721 agtggaaaag gggccctccc tacagcaagt tatgagagac cagctgaaac cattcacaga
     3781 gcccaggggc aaaccaccta gaccagcagt tttagaagag gctaaaaaga cagtgatgaa
     3841 cgttctagaa cagaccattg accctgctaa accatggact tactcacaag catgtgcttc
     3901 actggacaag accacttcta gtggaagccc ccaccatgtc aggaaaaatg accactggaa
     3961 tggggagtct tttactggtc ccctcgcgga ccaagcatcc aaagccaacc tcatgtatga
     4021 acaggcaaag catgtgcagc ccgtgtacac ggccgcgctc aaagatgaac ttgttaagac
     4081 tgataagatc tacaagaaaa taaagaagag acttctatgg gggtcagacc ttggcacgat
     4141 gatcaggtgt gccagggctt ttggcggcct tatggacagt atgaaagcaa gttgtatagc
     4201 ccttccatgc agggtgggga tgaacatgaa tgaggatggc cctatcatat ttgacaaaca
     4261 ctccaagtat aggtaccact atgatgctga ctactctagg tgggactcaa cccagcagag
     4321 gagcattctt tccgccgcca tggaggtgat ggtgaggttc tctgctgaac cagaattggc
     4381 acaagtggtc gcagaggacc ttttagcgcc tagccagcta gatgttggcg attttgtcat
     4441 ctcagtccag gagggcctgc catcaggagt cccatgtacg tcgcaatgga attcaatagc
     4501 gcactggatt ctaactctga gcgcaatggc agaagtgtca ggtctctcac cagacgttgt
     4561 ccaagcccac tcctgtttct cattttatgg cgacgatgag atcgtcagca ctgacatcaa
     4621 ccttgacccc atgaaattga cacagaaact cagggagtat ggtctggtcc ccacccggcc
     4681 tgataagact gaaggccccc tcgttataac tgaagacctc accggcctga cattcctgcg
     4741 cagatcgatt gcacgggatc cagctggatg gtttggaaaa ttggatcaag actcaatcct
     4801 caggcaatta tactggacaa gggggcccaa tcatgaaaac ccatacgaga gcatggttcc
     4861 ccactcccag cgagctactc agctcatggc ccttcttggt gaggcttcat tgcatggtcc
     4921 ccagttttac aagaaagtta gcaagatggt catcaatgag attaagagtg gtggtctgga
     4981 gttttatgtg cccagacaag aggccatgtt taggtggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga gagtgtgaat gaagatggcg tcgaatgacg
     5101 ccgctccatc aaatgatggt gctgccaacc tcgtaccaga ggccaataat gaggttatgg
     5161 cacttgaacc ggtggtggga gcttcaatcg cagctcctgt tgtcggtcag cagaatataa
     5221 ttgacccctg gattagagaa aattttgttc aagcaccaca gggcgagttt actgtttcac
     5281 caaggaactc gcccggtgag atgcttctaa atcttgaatt gggcccagaa cttaacccct
     5341 atttgagtca tttgtcccgc atgtacaatg ggtatgctgg tggcatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggga agatcatctt tgccgctgtg ccaccacact
     5461 tccctgtgga taatattagt gcagcccaga taactatgtg tccccatgtg attgttgatg
     5521 tgagacagct tgaaccagtg cttctacccc tccccgatat aaggaacagg ttcttccatt
     5581 acaaccagga agacaccccc cggatgaggc ttgtggccat gctctacacg cctctaaggg
     5641 ctaattccgg agaggatgtg ttcactgtgt cctgtagggt tctgactcgc cccgctccag
     5701 attttgaatt tacattctta gttccaccaa ctgttgaatc aaaaacaaaa ccctttactc
     5761 tacctattct aacccttggt gagctgtcta attcccgttt tcctgctgcc atagatatgc
     5821 tttacactga tcccaatgaa tcaatagttg ttcagcccca aaatggtaga tgtacccttg
     5881 acggcacgct gcaaggcaca acacaattgg tcccaacaca gatttgtgcc tttagaggta
     5941 ctctgatcag tcagaatgcg agagcggccg atttaacaga ttccccccag agagcccgtg
     6001 atcacccgtt gcacgtccag gtcaagaacc tagatggcac acagtatgac ccaacagatg
     6061 acatccctgc agtcctgggg gctattgact tcaaaggtac agtgttcgga gtggcaagtc
     6121 agagggacgt ctctggaaca caagaacagg gccattatgc cacccgggct catgaagcac
     6181 acattgacac aactgatcca aagtatgcac ctaaattagg cacaattctc attaaatctg
     6241 aatctactga tttcaccaca aatcagccca ttaggttcac tccagtgggc atgggcgaca
     6301 acaattggag acagtgggaa ttgcctgact attctggtag tttgactcta aatatgaacc
     6361 ttgcccctgc tgtttcccca tctttccctg gtgaacgaat ccttttcttt aggtctatag
     6421 taccatcagc tggaggctac gggtctggct atatagactg tctcataccc caggaatggg
     6481 tgcaacattt ctaccaggag gcagcacctt cgcaatccgc tgttgcactg gttaggtatg
     6541 tcaaccccga cactgggcgt aacatctttg aggccaagtt gcacagagaa gggttcctca
     6601 ccgtggccaa ttctggaaac aatcctattg tggttccccc taatggttat tttagatttg
     6661 aggcttgggt taatcaattc tatacacttg cccccatggg atctggacag gggcgtagaa
     6721 gagctcagta atggctggag ccttcttcgc agggttagca ggtgatgtcg tgtcgaacgg
     6781 catcggttcc ctcatcaatg caggtgctaa tgcagtcaat caaaaggttg agtatgattt
     6841 taataagcaa cttcagatgg catcattcaa acatgataag gagatgttac aatcacaggt
     6901 gttggcaacc aaacaactgc agcaggagat gatgaacata aagcagggga tgttgaccgc
     6961 tggcggcttt tctcctgcgg acgctgctag aggggctgtt aacgctccaa tgacaaaaat
     7021 actggactgg agtggcacaa gatattgggc acctaacagc atgaaaacca caagctactc
     7081 aggacaattc tctagtagcc ctgtccacag gtctcctgct cccctccagc acactgcccc
     7141 accaaaaagt aagttgcaaa gtgattctgc tagtgtgtat agctcccctt ccactgtttc
     7201 ttcacaatta actcattcaa cagtgttgtc tgcaggaact gggtcgtcca gatccacccc
     7261 cacgtccaca gcaacctcca ccctgtctag gaccagcgac tgggttagag gacagaatga
     7321 aaggcttggc ccgtttatgg atggtgctct ccaaactact tttgtcacac caccatcgag
     7381 caaagcttca tcagatggga cagtctcgac cgtgcccaaa gctgttttgg actcctggac
     7441 tcctatgttc aacacgcata ggcagcctct cttcgcccac ttgcgtaggc gaggggagtc
     7501 acagatttag tgaaaagagt gattaggctt tctttccttt cttccttccc ttttctctct
     7561 ttt
//