Typing tool

Complete norovirus genomes

KU561251  GII.17
 GII.P17

Length: 7,551 | 3 CDS

ORF1: 5..5113
ORF2: 5094..6710
ORF3: 6710..7489
LOCUS       KU561251                7551 bp    RNA     linear   VRL 10-MAY-2016
DEFINITION  Norovirus GII.17 strain Hu/GII.P17_GII.17/KR/2013/CAU-85, complete
            genome.
ACCESSION   KU561251
VERSION     KU561251.1
KEYWORDS    .
SOURCE      Norovirus GII.17
  ORGANISM  Norovirus GII.17
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7551)
  AUTHORS   Dang Thanh,H., Than,V.T., Nguyen,T.H., Lim,I. and Kim,W.
  TITLE     Emergence of Norovirus GII.17 Variants among Children with Acute
            Gastroenteritis in South Korea
  JOURNAL   PLoS ONE 11 (5), E0154284 (2016)
   PUBMED   27148739
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7551)
  AUTHORS   Hien,D.T. and Kim,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2016) Medical Microbiology, Chung-Ang University.
            College of Medicine, 221 Heukseok-dong, Dongjak-ku, Seoul, South
            Korea
FEATURES             Location/Qualifiers
     source          1..7551
                     /organism="Norovirus GII.17"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P17_GII.17/KR/2013/CAU-85"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:552592"
                     /country="South Korea"
                     /collection_date="2013"
     gene            1..5113
                     /gene="ORF1"
     CDS             5..5113
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ANC98486.1"
                     /translation="MKMASNDASAAVAGKNNNNDKEKSSSDSLFSNMTVTFKKALGAR
                     PKQPPPGETKQIQKPPRPPTPELVKRIPPPPPNGEDEPKIVYKVGEGVSGLPNLTTVA
                     QPDAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPA
                     AISLAKIELTPLSLYWRVVYTPQYLIAPETLKNLSGETFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRMIQRTTGFFRPYQDWNRKPLPTMDEPKIKKAANAVLCALSSLFTRPIKDI
                     IGKLRPLNILNILATCDWTFAGIVESMILLAELFGVFWTPPDVSAMIAPLLGDYEMQG
                     PEDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKW
                     FFPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARK
                     LSTKSASPDIVGTINSLLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLA
                     RELAKKVASTLSGDQRIGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     IEKAKRDFPGQPDMWKDHYRPDFTHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLI
                     ARASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSV
                     KTLDELKQAIKNISIKKCQIVYNGCTYTMESDGRSKVVVEKVQNATVQTNNELVGALH
                     HLRSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDEPEDK
                     GGCPKPRDEDDLTVDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREE
                     RNGKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATL
                     GLVTGSEIRKRNPDDFKPKGKLWADDNRSVDYHERIDFEAPPSVWSRIVNFGTGWGFW
                     VSPSLFITSTHVIPKGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGA
                     PEGTVVSILIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTT
                     PGDCGCPYIYKRGNDFVAIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKN
                     DYWSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWG
                     SDLSTMIRCARAFGGLMDELKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYS
                     RWDSTQQRAVLEVALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWT
                     RGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVP
                     RQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5094..6710
                     /gene="ORF2"
     CDS             5094..6710
                     /gene="ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="ANC98485.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYNNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAHNNVLQVQCQNGRCTLDGELQGTT
                     QLLPSGICAFRGRVTAETDHRDKWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGV
                     ASQRNVGNDAPGSTRAHEAVISTYSPQFVPKLGSVNFRSNDNDFQLQPTKFTPVGIND
                     DGDHPFRQWELPDYSGLLTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIVDCL
                     IPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLVVP
                     ANGYFRFDSWVNQFYSLAPMGTGNGRRTAQ"
     gene            6710..7489
                     /gene="ORF3"
     CDS             6710..7489
                     /gene="ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="ANC98487.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDKEMLQAHVKATKQLQSEMIALKQDVLAAGGFSPTDAARGAIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMPSPNAPQSKPAKPRSLAPSSSSSSVYSMSTQST
                     HLTSGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgtt gctggcaaaa acaacaacaa
       61 cgacaaggag aaatcttcaa gtgacagctt gttttctaac atgactgtta cttttaagaa
      121 agccctcggg gcgcggccta aacaaccgcc cccgggagaa acaaaacaaa tacaaaaacc
      181 accaaggcca ccgacaccgg aattggtgaa gagaataccc ccacccccac ccaatggcga
      241 ggatgaacca aagatagtgt ataaggtggg agagggtgtg tctgggctgc ccaacctaac
      301 aactgtggca cagcctgacg cacaaaacac agcttatagt gttcccccac ttagccagag
      361 agaagtcggc gaagctaaag aaccgctgcc tggctccatt ctggaaatgt gggatggtga
      421 gatctaccac tatgggctgt atgttgagcg ggggcatgta ctcggagtac acaaaccacc
      481 tgccgcaata agccttgcca aaattgaatt aacaccgctg tctctctact ggagagtggt
      541 ctacactccc cagtatttga tagctccaga aactcttaag aacttgagtg gagagacttt
      601 cccatacacg gcctttgaca acaactgtta tgccttctgt tgttgggtcc tagacctcaa
      661 cgactcctgg cttagcagga gaatgatcca aagaacaact ggattcttca gaccgtatca
      721 ggattggaac agaaaaccct taccaaccat ggatgaaccg aaaatcaaga aggccgcgaa
      781 tgctgttctg tgcgctctct cctcactctt cactagaccc attaaggaca tcattggaaa
      841 gcttagacca ctgaacattc ttaatatact ggcaacttgt gactggactt ttgcaggcat
      901 agtggaatcc atgatccttc ttgctgaact ctttggggtg ttctggaccc ccccagatgt
      961 gtctgcgatg attgctccct tactcggtga ctacgagatg caaggccccg aagacctggc
     1021 cgtggaactt gtgcccgtgg taatgggagg aataggtttg gtgttaggat tcaccaagga
     1081 aaagatcggc aagatgcttt catcagctgc gaccacactt agggcctgca aggatctagg
     1141 atcttatgga ttggagatac tcaaattggt catgaagtgg ttcttcccca agaaggagga
     1201 ggctaacgaa ctagccatgg tgagggccat tgaggatgca gtcctggatt tggaggcaat
     1261 agaaaacaat cacatgacca cccttctcaa ggataaagac agcctggcca catacatgag
     1321 gactcttgac ttggaagaag agaaagcaag gaaactgtca accaaatcgg cgtcacctga
     1381 catcgtgggt acaataaact cattattggc aaggatagca gccgccaggt cactggtcca
     1441 caaggctaag gaggagctct cgagcagaca gagacctgtt gttgtaatga tatcaggtag
     1501 accaggtata ggaaagaccc atctggccag agagctagcc aagaaagttg cgtcaacact
     1561 gtcaggcgac caaaggattg gactgatacc tagaaatggc gtcgaccatt gggacgccta
     1621 caagggagaa agggtggttc tgtgggatga ttatggtatg agcaacccta tacaggacgc
     1681 actgaggctc caagaattgg ctgacacctg tcctctgacc ctgaattgtg acaggattga
     1741 aaacaaaggg aaagtgttcg acagtgatgc cataattata acaaccaacc ttgcaaaccc
     1801 agcaccacta gactatgtca actttgaggc ctgctctaga cgcatagact tcttggtgta
     1861 tgcagacgca cctgacatcg agaaggctaa gcgtgatttc cctggccaac cagatatgtg
     1921 gaaagaccat tacagaccag acttcacaca cattaaactt cagctggcac cacagggagg
     1981 ttttgacaaa aatggcaaca ccccacatgg caaaggtgtg gtgaagtctc tgacgattgg
     2041 ttctctgatc gccagggctt ctggcttgct ccacgagaga atggatgaat tcgagctcca
     2101 gggctctgac ctgccaacct tcaattttga ccgcaacaaa gtcgccgcct tcagacaatt
     2161 agcagctgaa aacaaatatg gtcttatgga cacactgagg gtcggcaacc aactgaaaag
     2221 tgtcaagacc ctggatgagc tgaaacaggc cataaagaac atcagtatca agaagtgcca
     2281 gatagtgtat aatggatgca cctataccat ggaatctgat gggaggagca aggttgtggt
     2341 tgaaaaggta caaaacgcaa cagttcaaac caacaatgaa cttgtagggg cactccacca
     2401 cctgagatct gcaaggataa gatactatgt taaatgtttc caagaagcca tttactctct
     2461 actccaaatt gctggtgcag ccttcgtcac ctcacgcatc gtgaggcgca tgaacatctc
     2521 aaacctctgg tcgaagccac ccatcgagga gggtgatgag cctgaagaca aaggaggatg
     2581 ccccaagccc agggatgaag atgacctcac tgttgactct agagacatta aagtggaagg
     2641 gaagaagggc aagaacaagt ctggtcgggg caagaaacac acagccttct catccaaggg
     2701 cctcagtgat gaagagtacg atgagtacaa gagaatcaga gaggagagga atggcaaata
     2761 ctcaatagag gaatacctcc aagataggga cagatactat gaagagcttg ccattgctaa
     2821 ggccactgag gaggacttct gtgaagagga ggagatcaaa atccgccaga gaatcttccg
     2881 acccaccagg aagcagcgga aagaggaaag ggccacgctt gggcttgtca caggatcgga
     2941 aatcagaaag aggaatccag atgactttaa accaaaagga aaattgtggg ctgatgacaa
     3001 caggagcgtg gattaccatg agaggataga ttttgaggct cccccgagtg tttggtctag
     3061 gatagtcaac tttggcacag gctggggatt ctgggtttct ccaagtctct ttataacttc
     3121 aacacacgtc ataccaaaag gaatcactga ggcctttgga gtacccataa accaaatcca
     3181 aattcacaaa tctggagaat tttgccgctt gcggtttcca aagccaatca gaccagacgt
     3241 gagtgggatg atcttggaag agggtgcccc tgaaggcact gttgtgtcta ttctcatcaa
     3301 aaggacaaca ggggagctga tgcctcttgc agtcagaatg gggactcatg ccacaatgaa
     3361 aatccaaggt agaacggtgg gtggtcagat gggtatgctt ctcactggct caaatgctaa
     3421 aagcatggat ctaggtacaa cgccaggtga ctgcgggtgt ccatacatat acaaaagggg
     3481 caatgacttc gtggccattg gggtgcacac tgcagcagca cgtggaggca acacggtcat
     3541 atgtgccaca cagggaagtg aaggtgaagc cactcttgaa ggaggtgaca acaagggtac
     3601 ctattgtgga gcccccattt tgggacctgg caatgcacca aaattgagca caaaaacaaa
     3661 attctggaga tcctctaacg caccgcttcc cccaggtact tatgaaccag cataccttgg
     3721 tgggagagac ccgcgcgtga agggaggccc atctctgcaa caagttatga gagaccaact
     3781 taaacctttt acagagccca gagggaagcc accaaaccca aatgtcctag agtcagcaaa
     3841 gaagactatc atcaatgttc tggagcaaac cattgacccc cctcaaaagt ggtcatatgc
     3901 ccaagcttgt gcatccctcg acaagacaac ctccagtgga tacccgcacc acgtccggaa
     3961 gaatgactat tggagtggtg aatccttcac agggaaactt gcagaccagg cttcaaaagc
     4021 aaatctcatg tatgaggaag gcaagcacat gcaaccagtt tacaccgcag cactcaaaga
     4081 cgagctcgtg aaaactgaca aaatttatgg caagatcaag aaaagactcc tgtggggttc
     4141 tgacctctcc accatgattc gatgcgccag agcatttggt ggtctcatgg atgagctcaa
     4201 agcaaattgt attacactcc ctatcagagt tggtatgaat atgaatgaag acggtcccat
     4261 aatatttgag aaacactcca ggtacaggta ccactatgat gctgattact cccgctggga
     4321 ctccacacaa cagcgggcag tgctggaagt ggcacttgaa atcatggtga gattttctgc
     4381 tgagccacag ctggcacaaa tagtggcaga ggacctgctg tcaccaagtg tggttgatgt
     4441 gggcgatttc aaaatcgcta tcaatgaagg cctaccatct ggcgtgcctt gcacctcaca
     4501 atggaattct attgcccatt ggttactcac cctgtgtgcc ctttctgaag tgacaggact
     4561 aggtcctgac atcatacaag ccaactccat gtactctttc tatggtgatg atgagattgt
     4621 gagcacagac ataaaattgg acccagagaa attgaccgca aagctcaaag aatatggcct
     4681 taaacccact cggcccgaca aaactgaggg gccgctggtg attagtgaag acctgaatgg
     4741 gttgactttc ctccgccgaa cagtcacccg tgatccagca ggttggtttg gaaagttgga
     4801 ccaaaactcc atcctcaggc agttgtactg gacaagagga cccaaccatg aagaccccag
     4861 tgagaccatg ataccacacg cacagagacc tgtgcagctc atggcactac taggagaatc
     4921 ctccctacat ggaccctcat tttacagcaa ggttagcaaa ctggtcatat ctgaacttaa
     4981 agagggagga atggattttt atgtgcccag acaagagtca atgttcagat ggatgaggtt
     5041 ctcagatcta agcacatggg agggcgatcg caatctggct cccagttttg tgaatgaaga
     5101 tggcgtcgaa tgacgccgct ccatctaatg atggtgctgc tggtctcgta ccagagggca
     5161 acaacgagac ccttccccta gaaccagttg cgggcgcagc tatagccgca cccgtcactg
     5221 gccaaaacaa cataattgac ccctggatta gaacaaattt tgtgcaagca ccaaatgggg
     5281 agttcacagt gtcacccaga aactcccctg gagaaatttt actaaaccta gagttgggcc
     5341 ctgatttgaa cccttatttg gctcatttgt caaggatgta caatgggtat gctggtggag
     5401 tggaagttca ggttctcctg gcagggaacg cgttcactgc cggaaagatc ctcttcgccg
     5461 ccgtcccgcc aaatttccca gtggaattct taagcccagc ccagattaca atgctcccac
     5521 atttaatagt agatgtcagg actcttgaac caattatgat cccactccct gatgttagga
     5581 atacattctt ccattataac aaccagccta acagccgcat gagattagtg gctatgctct
     5641 acacccccct tagatctaat ggctcaggtg atgatgtctt tactgtctct tgcagggttt
     5701 tgactaggcc tactcctgat tttgagttca cttatttagt gccaccttct gttgaatcta
     5761 agactaagcc tttttcctta cctattttaa ccctttctga gctcacaaat tcgaggttcc
     5821 cagtccccat cgattcgctt ttcaccgccc acaataatgt gttgcaggtg cagtgtcaaa
     5881 acggcaggtg cacacttgat ggtgagttac aaggcacaac ccagttgctc ccatctggca
     5941 tctgtgcatt cagaggacgg gtgacagcag aaactgacca tcgagacaag tggcacatgc
     6001 aactgcaaaa cctcaatggc acaacatatg acccaactga tgatgtgcca gccccgctgg
     6061 gtacacctga cttcaagggc gtcgtgtttg gggtagcaag ccaaagaaat gtgggtaatg
     6121 atgcgcctgg ctcaaccagg gcccatgagg cggtgatttc aacctatagc ccccaatttg
     6181 tccctaaatt aggttctgtc aattttagaa gtaatgataa tgatttccaa ttgcagccga
     6241 caaaattcac accagtgggc atcaatgacg atggtgacca cccgttcaga cagtgggaac
     6301 taccagacta ttcagggctg cttaccttga atatgaacct cgcccccccg gttgctccaa
     6361 atttccctgg tgaacaatta ttattcttca gatcttttgt gccatgctca ggaggttata
     6421 accaaggcat tgtagattgt cttattcccc aagaatggat ccaacacttc tatcaggaat
     6481 cagcgccctc ccagtcagac gtggccctaa tcaggtatgt taaccccgat acgggacgta
     6541 cactgtttga agcaaaattg cacagatctg gttacattac tgtggctcac tctggagact
     6601 atcctcttgt tgttccggct aatggatatt tcagatttga ttcttgggta aatcagtttt
     6661 actcactcgc cccaatggga actgggaatg ggcgaaggac ggctcagtaa tggctggagc
     6721 tttcattgca ggattggcag gcgacatgct cacgtcatcc gtgggctccc tggtgaacgc
     6781 aggggcaaac gccatcaacc aaaagataga ctttgaaaac aacaaacaac tccagtctgc
     6841 ttcctttcag catgataaag agatgctcca agcgcacgtg aaggcaacca agcagctgca
     6901 atctgaaatg atagccctaa aacaggacgt tttggccgca ggcggctttt cccccactga
     6961 tgcagcaagg ggagccattg gtgcacccat gacaaaggtg cttgactggt ctggcactcg
     7021 atactgggca cccaattcca caaagacaac tggttattcg ggacaattca cctcttcacc
     7081 tgtgcacatg cctagcccaa atgctccaca atcaaaacct gcaaagccta ggtctctagc
     7141 tccttcctct tcttctagta gtgtctatag tatgtctact caatcaactc atttaacatc
     7201 tggctcttct agtaatgctt cttctgcctc tacaaaattg acaaacttaa gctctggctc
     7261 ctctcaaaac agaacagcag agtgggtgaa ccaacagaga agtcttagcc ctttcatgag
     7321 tggcgcactc aatatctcac atgtcacgcc accctcaagt agggcttcca gttctgggac
     7381 ggtctcgacc gtgcccaagg aagttttgga ctcctggacg tctgcgttta acacacacag
     7441 acagccgctc ttcgcacacc tcagagtgag gggggagtca cgtgtttagt gaaaagaaat
     7501 aattggctat aatgtgattt ctttttaaaa attggctatt ttgtatcttt t
//