Typing tool

Complete norovirus genomes

KU561248  GII.17
 GII.P17

Length: 7,559 | 3 CDS

ORF1: 4..5106
ORF2: 5087..6709
ORF3: 6709..7488
LOCUS       KU561248                7559 bp    RNA     linear   VRL 28-JUL-2017
DEFINITION  Norovirus GII.17 isolate GII/Hu/HKG/2015/GII.17/CUHK-NS-613,
            complete genome.
ACCESSION   KU561248
VERSION     KU561248.1
KEYWORDS    .
SOURCE      Norovirus GII.17
  ORGANISM  Norovirus GII.17
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Chan,M.C.W., Hu,Y., Chen,H., Podkolzin,A.T., Zaytseva,E.V.,
            Komano,J., Sakon,N., Poovorawan,Y., Vongpunsawad,S.,
            Thanusuwannasak,T., Hewitt,J., Croucher,D., Collins,N., Vinje,J.,
            Pang,X.L., Lee,B.E., de Graaf,M., van Beek,J., Vennema,H.,
            Koopmans,M.P.G., Niendorf,S., Poljsak-Prijatelj,M., Steyer,A.,
            White,P.A., Lun,J.H., Mans,J., Hung,T.N., Kwok,K., Cheung,K.,
            Lee,N. and Chan,P.K.S.
  TITLE     Global Spread of Norovirus GII.17 Kawasaki 308, 2014-2016
  JOURNAL   Emerging Infect. Dis. 23 (8), 1350-1354 (2017)
   PUBMED   28726618
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Chan,M.C.W., Cheung,K.K.W., Hung,T.T.N., Kwok,K.T.T. and
            Chan,P.K.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2016) Department of Microbiology, The Chinese
            University of Hong Kong, Shatin 852, Hong Kong
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus GII.17"
                     /mol_type="genomic RNA"
                     /isolate="GII/Hu/HKG/2015/GII.17/CUHK-NS-613"
                     /host="Homo sapiens"
                     /db_xref="taxon:552592"
                     /country="Hong Kong"
                     /collection_date="01-Mar-2015"
                     /note="genotype: GII.17"
     gene            4..5106
                     /gene="ORF1"
     CDS             4..5106
                     /gene="ORF1"
                     /codon_start=1
                     /product="ORF1"
                     /protein_id="ANW12064.1"
                     /translation="MASNDASAAVAGKNNNNDKEKSSSDSLFANMSVTFKKALGARSK
                     QPPPGETKQIQKPPRPPTPELVKRIPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVVQP
                     DAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPAAI
                     SFAKIEITPLSLYWRVVYTPQYLIDPGTLKNLSGETFPYTAFDNNCYAFCCWVLDLND
                     SWLSRRMIQRTTGFFKPYQDWNRKPLPTMDEPKIKKAANAVLCALSSLFTRPIKDIIG
                     KLRPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLS
                     TKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLARE
                     LAKKVASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELADT
                     CPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDIE
                     KAKRDFPGQPDMWKDHFRPDFSHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLIAR
                     ASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSVKT
                     LDELKQAIKNISIKKCQIVYNGCTYTMESDGRGKVVVEKVQNATVQTNNELVGALHHL
                     RSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDEPEDRGG
                     CPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERN
                     GKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGL
                     VTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFWVS
                     PSLFITSTHVIPKGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGAPE
                     GTVVSILIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDLVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPIL
                     GPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTE
                     PRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKNDY
                     WSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWGSD
                     LSTMIRCARAFGGLMDEFKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRW
                     DSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWTRG
                     PNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVPRQ
                     ESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5087..6709
                     /gene="VP1"
     CDS             5087..6709
                     /gene="VP1"
                     /note="viral protein 1"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ANW12065.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLPSGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
                     VSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
                     DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
                     CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV
                     VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     gene            6709..7488
                     /gene="VP2"
     CDS             6709..7488
                     /gene="VP2"
                     /note="viral protein 2"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ANW12066.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDKEMLQAQVRATKQLQSEMIALKQGVLAAGGFSPTDAARGSIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMSSPNAPQSKPAKPRSLAPSSSSSSVYSMYTQST
                     HLTSGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN      
        1 aagatggcgt ctaacgacgc ttccgctgcc gttgctggca aaaacaacaa caacgacaag
       61 gaaaaatctt caagtgacag cttgtttgct aacatgtctg tcacttttaa gaaagccctc
      121 ggggcgcggt ctaaacaacc gcccccggga gaaacaaaac aaatacaaaa accaccaagg
      181 ccaccgacac cggaattggt gaagagaata cctccacccc cacccaatgg cgaggatgaa
      241 ccagggatag tgtacaaggt gggagagggt gtgtctgggc tgcccgacct aacaactgtg
      301 gtacaacctg acgcacaaaa cacagcttat agtgttcccc cacttagcca gagagaagtc
      361 ggcgaagcta aagaaccgct gcctggctcc attctggaaa tgtgggatgg tgagatctac
      421 cactatgggc tgtatgttga gcgggggcat gtgctcggag tacacaaacc acctgctgca
      481 ataagctttg ccaaaattga aataacaccg ctgtctctct actggagagt ggtctacact
      541 ccccagtatt tgatagatcc aggaactctt aagaacttga gtggagagac tttcccatac
      601 acggcctttg acaacaactg ttatgccttc tgttgttggg tcctagacct caacgactcc
      661 tggcttagca ggagaatgat ccaaagaaca actggattct tcaaacctta tcaggattgg
      721 aacagaaaac ccttaccaac catggatgaa ccgaaaatca agaaggccgc gaatgctgtc
      781 ctatgcgctc tctcctcact cttcactaga cccattaagg acatcattgg aaagcttaga
      841 ccactgaaca ttcttaatat actggcaacc tgcgattgga cttttgcagg catagtggaa
      901 tccttgatcc ttcttgctga actctttggg gtgttctgga cacccccaga cgtgtctgcg
      961 atgattgctc ccttactcgg tgactacgag atgcaaggcc ccgaagacct ggccgtggaa
     1021 cttgtgcccg tggtgatggg aggaataggt ttggtgttag gattcaccaa agaaaagatc
     1081 ggcaagatgc tttcatcagc tgcgaccaca cttagggcct gcaaggatct aggatcttat
     1141 ggattggaga tactcaaatt ggtcatgaag tggttcttcc ccaagaagga ggaggctaac
     1201 gaactagcca tggtgagggc cattgaggat gcagtcctgg atttggaggc aatagaaaac
     1261 aatcacatga ccacccttct caaggataaa gacagcctgg ccacatacat gaggactctt
     1321 gacttggaag aagagaaagc aaggaaactg tcaaccaaat cggcgtcacc tgacatcgtg
     1381 ggtacaataa acgcattatt ggctaggata gcagccgcca ggtcactggt ccacaaggct
     1441 aaggaggagc tctcgagcag acagagacct gttgttgtaa tgatatcagg tagaccaggt
     1501 ataggaaaga cccatctggc cagagagcta gccaagaaag ttgcgtcaac actgtcaggc
     1561 gaccaaagga ttggactggt acctagaaat ggcgtcgacc attgggacgc ctacaaggga
     1621 gaaagggtgg ttctgtggga tgattatggt atgagcaacc ctatacagga cgcactgagg
     1681 ctccaagaat tggctgacac ctgtcctctg accctaaatt gtgataggat tgaaaacaaa
     1741 ggaaaagtgt tcgacagtga tgccataatt ataacaacca accttgcaaa cccagcacca
     1801 ctagactatg tcaactttga ggcctgctct agacgcatag acttcttggt gtatgcagac
     1861 gcacctgaca ttgagaaggc taagcgtgac ttccctggcc aaccagatat gtggaaagac
     1921 catttcagac cagacttttc acacattaaa cttcagctgg caccacaggg aggttttgac
     1981 aaaaatggca acaccccaca tggcaaaggt gtggtgaagt ccctgacgat tggttctctg
     2041 atcgccaggg cctccggctt gctccacgag agaatggatg aattcgagct ccaaggctct
     2101 gacctgccaa ccttcaattt tgaccgcaac aaagtcgccg ccttcagaca attagcagct
     2161 gaaaacaaat atggtcttat ggacacactg agggtcggca accaactgaa aagtgttaag
     2221 accctggatg agctgaagca ggccataaag aacatcagta tcaagaagtg tcagatagtg
     2281 tataatggat gcacctatac catggaatct gatgggaggg gcaaggttgt ggttgaaaag
     2341 gtacaaaacg caacagttca aaccaacaat gaacttgtag gggcgctcca ccacctgaga
     2401 tctgcaagga taagatacta tgttaaatgt ttccaagaag ccatttactc tctactccaa
     2461 attgctggtg cagccttcgt cacctcacgc atcgtgaggc gcatgaacat atcaaacctc
     2521 tggtcgaagc cacccatcga ggagggtgat gagcctgaag acagaggagg atgccccaag
     2581 cccagggatg aagatgacct cactattgac tctagagaca ttaaagtgga agggaagaag
     2641 ggcaagaaca agtctggccg gggcaagaaa cacacagcct tctcttccaa gggcctcagt
     2701 gatgaagagt acgatgagta caagagaatc agagaggaga ggaatggcaa atactcaata
     2761 gaggaatacc tccaagatag ggacagatac tatgaagagc ttgccattgc taaggccact
     2821 gaggaggact tctgtgagga ggaggagatc aaaatccgcc agagaatctt ccgacccacc
     2881 aggaagcagc ggaaagagga aagggccacg cttgggcttg tcacaggatc ggaaatcaga
     2941 aagaggaatc cagatgactt taaaccaaaa ggaaaattgt gggctgatga caacaggagc
     3001 gtggattaca atgagaggat agattttgag gctcccccga gtgtttggtc taggatagtc
     3061 aactttggca caggctgggg attctgggtt tctccaagtc tctttataac ttcaacacac
     3121 gtcataccaa aaggaatcac tgaggccttt ggagtgccca taaaccaaat ccaaattcac
     3181 aaatctggag aattttgccg cttgcggttt ccaaagccaa ttagaccaga cgtgagtggg
     3241 atgatcttgg aagagggcgc ccctgaaggc actgttgtgt ctattctcat caaaaggaca
     3301 acaggggagc tgatgcctct tgcagtcaga atggggactc atgccacaat gaaaatccaa
     3361 ggtagaacgg tgggtggtca gatgggtatg cttctcactg gctcaaatgc taaaagcatg
     3421 gatctaggca caacgccagg tgactgcgga tgtccataca tatacaaaag gggcaatgac
     3481 cttgtggtca ttggggtgca cactgcagca gctcgtggag gcaacacggt catatgtgcc
     3541 acacagggaa gtgaaggtga agccactctt gaaggaggtg acaacaaggg tacctattgt
     3601 ggagccccca ttttgggacc tggcaatgca ccaaaattga gcacaaagac aaaattctgg
     3661 agatcctcta acgcaccgct tcccccaggt acttatgaac cagcatacct tggtgggaga
     3721 gacccgcgcg tgaagggagg cccatctctg caacaagtta tgagagacca acttaaacct
     3781 tttacagagc ccagagggaa gccaccaaac ccaaatgtct tagagtcagc aaagaagact
     3841 atcatcaatg ttctggaaca aaccattgac cctcctcaaa agtggtcata tgcccaagct
     3901 tgtgcatccc tcgacaagac aacctccagt ggatacccgc accacgtccg gaagaatgac
     3961 tattggagtg gtgaatcctt cacaggaaaa cttgcagatc aggcttcaaa agcaaatctc
     4021 atgtatgagg aaggcaagca catgcaacca gtttacaccg cagcactcaa agacgagctc
     4081 gtgaaaactg acaaaattta tggcaaaatc aagaaaagac tcctgtgggg ttctgacctc
     4141 tccacaatga ttcgatgcgc cagagcattt ggcggtctca tggatgaatt caaagcaaat
     4201 tgtattacac tccctatcag agttggtatg aatatgaatg aagatggtcc cataatattt
     4261 gagaaacact ccaggtacag gtaccactat gatgctgatt actcccgctg ggactccaca
     4321 caacagcggg cagtgctgga agcggcactt gaaatcatgg tgagattttc tgctgagcca
     4381 cagctggcac aaatagtggc agaggacctg ctgtcaccaa gtgtggttga tgtgggcgat
     4441 ttcaaaatcg ctatcaatga aggcctacca tctggcgtgc cttgcacctc acaatggaat
     4501 tctattgccc actggttact taccttgtgt gccctttctg aagtgacagg attaggtcct
     4561 gacatcatac aagctaactc catgtactct ttctatggtg atgatgagat tgtgagcaca
     4621 gacataaaat tggacccaga gaaattgacc gcaaagctca aagaatatgg ccttaaaccc
     4681 actcggcccg acaaaactga ggggccgttg gtgattagtg aggacctgaa tgggttgact
     4741 ttcctccgcc gaacagtcac ccgtgatcca gcaggttggt ttggaaagtt ggaccaaaac
     4801 tccatcctca ggcagttgta ctggacaaga ggacccaacc atgaagaccc cagtgagacc
     4861 atgataccac acgcacaaag acctgtgcag ctcatggcac tactaggaga atcctcccta
     4921 catggaccct cattttacag caaggttagc aaattagtca tatctgaact taaagaggga
     4981 ggaatggatt tttatgtgcc cagacaagag tcaatgttca gatggatgag gttctcagat
     5041 ctaagcacat gggagggcga tcgcaatctg gctcccagtt ttgtgaatga agatggcgtc
     5101 gaatgacgcc gctccatcta atgatggtgc tgctggtctc gtaccagagg gcaacaacga
     5161 gacccttccc ctagaaccag ttgcgggcgc agctatagcc gcacccgtca ctggccaaaa
     5221 taacataatt gacccctgga ttagaacaaa ttttgtgcaa gcaccaaatg gagagttcac
     5281 agtgtcaccc agaaactctc ctggagaaat tttattaaac ttagagttgg gccctgattt
     5341 gaacccttat ttggctcatt tgtcaaggat gtacaatggg tatgctggtg gagtggaagt
     5401 tcaggttctc ctggcaggga acgcgttcac tgccggaaag atcctcttcg ccgccgtccc
     5461 gccaaatttc ccagtggaat tcttaagccc agcccagatc acaatgctcc cacatttaat
     5521 agtagatgtt aggactcttg aaccaattat gatcccactc cctgatgtta ggaatacatt
     5581 cttccattat agtaaccagc ctaacagccg catgagatta gtggctatgc tctatacccc
     5641 actcagatct aatggctcag gtgatgatgt ctttactgtc tcttgcaggg ttttgactag
     5701 gcctactcct gattttgagt tcacttattt agtgccacct tctgttgaat ctaaaactaa
     5761 gcctttttcc ttacctattt taaccctttc tgagctcaca aattcgaggt tcccagtccc
     5821 catcgattcg cttttcaccg cccagaataa tgtgttgcag gtgcagtgtc aaaatggcag
     5881 gtgtacactt gatggtgagt tacaaggcac aacccagttg ctcccatctg gcatctgtgc
     5941 attcagagga cgggtgacag cacaaattaa ccaacgtgac aggtggcaca tgcaactgca
     6001 aaacctcaat ggtacaacat atgacccaac tgatgatgtg ccagccccgc tgggtacacc
     6061 tgacttcaag ggcgtcgtgt ttgggatggt aagccaaaga aatgtgggta atgatgcgcc
     6121 tggctcaacc agagcccaac aggcgtgggt ttcaacctat agcccccaat ttgtccccaa
     6181 attaggttct gtcaatctta gaattagtga taatgatgat ttccaattcc agccgacaaa
     6241 attcacacca gtgggcgtca atgatgacga tgatggccac ccgttcagac aatgggaact
     6301 accaaactat tcaggggagc ttaccttgaa tatgaatctt gcccccccag ttgctccaaa
     6361 ttttcctggt gaacaattgt tattcttcag atctttcgtg ccatgctcag gaggttacaa
     6421 ccaaggtatt atagattgtc ttattcccca agaatggatc caacacttct atcaggaatc
     6481 agcaccctcc cagtcagacg tggccctaat caggtatgtc aaccccgata cgggacgtac
     6541 actgtttgaa gcaaaattgc acagatctgg ttacattact gtggctcact ctggagacta
     6601 tcctcttgtt gttccggcta atggacactt tagatttgat tcttgggtaa atcagtttta
     6661 ctcactcgcc ccaatgggaa ctgggaatgg gcgaaggagg gctcagtaat ggctggggct
     6721 ttcattgcag gattggcagg cgacatgctc acgtcatctg tgggctccct tgtgaacgca
     6781 ggggcaaacg ccatcaacca aaagatagac tttgaaaaca acaaacaact ccagtctgct
     6841 tcctttcagc atgataaaga gatgctccaa gcgcaggtga gggcaaccaa gcagctgcaa
     6901 tctgaaatga tagccctaaa acagggggtt ttggccgcag gcggcttttc ccccactgat
     6961 gcagcaaggg gatccattgg tgcacccatg acaaaggtgc ttgactggtc tggcactcga
     7021 tactgggcgc ccaattccac aaagacaact ggctattcgg gacaattcac ctcttcacct
     7081 gtgcatatgt ctagcccaaa tgctccacaa tcaaaacctg caaagcctag gtctctagct
     7141 ccttcctctt cttctagcag tgtctatagt atgtatactc aatctactca tttaacatct
     7201 ggctcttcta gtaatgcttc ttctgcctcc acaaaattga caaatttaag ctctggctcc
     7261 tctcaaaaca gaacagcaga gtgggtaaat caacagagaa gtcttagccc tttcatgagt
     7321 ggcgcactta acatctcaca tgtcacgcca ccctcaagta gggcttccag ttctgggacg
     7381 gtctcgaccg tgcccaagga agttttggac tcctggacgt ctgcgtttaa cacacacaga
     7441 cagccgctct tcgcacacct cagagtgagg ggggagtcac gtgtttagtg aaaagaaata
     7501 attggctata atgtgatttc tttctaaatt tggctaattt gtatctttta aaaaaaaaa
//