Typing tool

Complete norovirus genomes

KT992787  GII.17
 GII.P17

Length: 7,499 | 3 CDS

ORF1: 4..5112
ORF2: 5093..6715
ORF3: 6715..7494
LOCUS       KT992787                7499 bp    RNA     linear   VRL 15-NOV-2015
DEFINITION  Norovirus Hu/GII.17/HN03/Nanyang/CHN/2015, partial genome.
ACCESSION   KT992787
VERSION     KT992787.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.17/HN03/Nanyang/CHN/2015
  ORGANISM  Norovirus Hu/GII.17/HN03/Nanyang/CHN/2015
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7499)
  AUTHORS   Huang,X., Su,J., Lu,Q., Xu,B., Li,Y., Li,S., Zhao,J., Li,M. and
            Shen,X.
  TITLE     Acute gastroenteritis outbreak caused by human Norovirus GII.17 in
            a university in Henan province, China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7499)
  AUTHORS   Huang,X., Su,J., Lu,Q., Xu,B., Li,Y., Li,S., Zhao,J., Li,M. and
            Shen,X.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-NOV-2015) Henan Key Laboratory of Pathogenic
            Microorganisms, Henan Center for Disease Control and Prevention,
            No. 105 South Agricultural Road Zhengdong New District, Zhengzhou,
            Henan 450016, China
FEATURES             Location/Qualifiers
     source          1..7499
                     /organism="Norovirus Hu/GII.17/HN03/Nanyang/CHN/2015"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.17/HN03/Nanyang/CHN/2015"
                     /host="Homo sapiens"
                     /db_xref="taxon:1749328"
                     /country="China"
                     /collection_date="Mar-2015"
                     /note="genotype: GII.17"
     gene            4..5112
                     /gene="ORF1"
     CDS             4..5112
                     /gene="ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ALN44208.1"
                     /translation="MKMASNDASAAVAGKNNNNDKEKSSSDSLFANMSVTFKKALGAR
                     SKQPPPGETKQIQKPPRPPTPELVKRIPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVV
                     QPDAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPA
                     AISLAKIEITPLSLYWRVVYTPQYLIDPGTLKNLSGETFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRMIQRTTGFFKPYQDWNRKPLPTMDEPKIKKAANAVLCALSSLFTRPIKDI
                     IGKLRPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQG
                     PEDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKW
                     FFPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARK
                     LSTKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLA
                     RELAKKVASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     IEKAKRDFPGQPDMWKDHFRPDFSHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLI
                     ARASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSV
                     KTLDELKQAIKNISIKKCQIVYNGCTYTMESDGRGKVVVEKVQNATVQTNNELVGALH
                     HLRSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDEPEDR
                     GGCPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREE
                     RNGKYSIEEYLQDRDKYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATL
                     GLVTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFW
                     VSPSLFITSTHVIPKGITDAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGA
                     PEGTVVSILIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTT
                     PGDCGCPYIYKRGNDLVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKN
                     DYWSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWG
                     SDLSTMIRCARAFGGLMDEFKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYS
                     RWDSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWT
                     RGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVP
                     RQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5093..6715
                     /gene="VP1"
     CDS             5093..6715
                     /gene="VP1"
                     /codon_start=1
                     /product="viral protein 1"
                     /protein_id="ALN44209.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLPSGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
                     VSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
                     DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
                     CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV
                     VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     gene            6715..7494
                     /gene="VP2"
     CDS             6715..7494
                     /gene="VP2"
                     /codon_start=1
                     /product="viral protein 2"
                     /protein_id="ALN44210.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDKEMLQAQVRATKQLQSEMIALKQGVLAAGGFSPTDAARGSIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMSSPNAPQSKPAKPRSLAPSSSSSSVYSMYTQST
                     HLTSGSSSSASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgcttcc gctgccgttg ctggcaaaaa caacaacaac
       61 gacaaggaaa aatcttcaag tgacagcttg tttgctaaca tgtctgtcac ttttaagaaa
      121 gccctcgggg cgcggtctaa acaaccgccc ccgggagaaa caaaacaaat acaaaaacca
      181 ccaaggccac cgacaccgga attggtgaag agaatacctc cacccccacc caatggcgag
      241 gatgaaccag ggatagtgta caaggtggga gagggtgtgt ctgggctgcc cgacctaaca
      301 actgtggtac aacctgacgc acaaaacaca gcttatagtg ttcccccact tagccagaga
      361 gaagtcggcg aagctaaaga accgctgcct ggctccattc tggaaatgtg ggatggtgag
      421 atctaccact atgggctgta tgttgagcgg gggcatgtgc tcggagtaca caaaccacct
      481 gctgcaataa gccttgccaa aattgaaata acaccgctgt ctctctactg gagagtggtc
      541 tacactcccc agtatttgat agatccagga actcttaaga acttgagtgg agagactttc
      601 ccatacacgg cctttgacaa caactgttat gccttctgtt gttgggtcct agacctcaac
      661 gactcctggc ttagcaggag aatgatccaa agaacaactg gattcttcaa accttatcag
      721 gattggaaca gaaaaccctt accaaccatg gatgaaccga aaatcaagaa ggccgcaaat
      781 gctgtcctat gcgctctctc ctcactcttc actagaccca ttaaggacat cattggaaag
      841 cttagaccac tgaacattct taatatactg gcaacctgcg attggacttt tgcaggcata
      901 gtggaatcct tgatccttct tgctgaactc tttggggtgt tctggacacc cccagatgtg
      961 tctgcgatga ttgctccctt actcggtgac tacgagatgc aaggccccga agacctggcc
     1021 gtggaacttg tgcccgtggt gatgggagga ataggtttgg tgttaggatt caccaaagaa
     1081 aagatcggca agatgctttc atcagctgcg accacactta gggcctgcaa ggatctagga
     1141 tcttatggat tggagatact caaattggtc atgaagtggt tcttccccaa gaaggaggag
     1201 gctaacgaac tagccatggt gagggccatt gaggatgcag tcctggattt ggaggcaata
     1261 gaaaacaatc acatgaccac ccttctcaag gataaagaca gcctggccac atacatgagg
     1321 actcttgact tggaagaaga gaaggcaagg aaactgtcaa ccaaatcggc gtcacctgac
     1381 atcgtgggta caataaacgc attattggct aggatagcag ccgccaggtc actggtccac
     1441 aaggctaagg aggagctctc gagcagacag agacctgttg ttgtaatgat atcaggtaga
     1501 ccaggtatag gaaagaccca tctggccaga gagctagcca agaaagttgc gtcaacactg
     1561 tcaggcgacc aaaggattgg actggtacct agaaatggcg tcgaccattg ggacgcctac
     1621 aagggagaaa gggtggttct gtgggatgat tatggtatga gcaaccctat acaggacgca
     1681 ctgaggctcc aagaattggc tgacacctgt cctctgaccc taaattgtga taggattgaa
     1741 aacaaaggaa aagtgttcga cagtgatgcc ataattataa caaccaacct tgcaaaccca
     1801 gcaccactag actatgtcaa ctttgaggcc tgctctagac gcatagactt cttggtgtat
     1861 gcagacgcac ctgacattga gaaggctaag cgtgacttcc ccggccaacc agatatgtgg
     1921 aaagaccatt tcagaccaga cttctcacac attaaacttc agctggcacc acagggaggt
     1981 tttgacaaaa atggcaacac cccacatggc aaaggtgtgg tgaagtccct gacgattggt
     2041 tctctgatcg ccagggcctc cggcttgctc cacgagagaa tggatgaatt cgagctccaa
     2101 ggctctgacc tgccaacctt caattttgac cgcaacaaag tcgccgcctt cagacaatta
     2161 gcagctgaaa acaaatatgg tcttatggac acactgaggg tcggcaacca actgaaaagt
     2221 gttaagaccc tggatgagct gaagcaggcc ataaagaaca tcagtatcaa gaagtgtcag
     2281 atagtgtata atggatgcac ctataccatg gaatctgatg ggaggggcaa ggttgtggtt
     2341 gaaaaggtac aaaacgcaac agttcaaacc aacaatgaac ttgtaggggc gctccaccac
     2401 ctgagatctg caaggataag atactatgtt aaatgtttcc aagaagccat ttactctcta
     2461 ctccaaattg ctggtgcagc cttcgtcacc tcacgcatcg tgaggcgcat gaacatatca
     2521 aacctctggt cgaagccacc catcgaggag ggtgatgagc ctgaagacag aggaggatgc
     2581 cccaagccca gggatgaaga tgacctcact attgactcta gagacattaa agtggaaggg
     2641 aagaagggca agaacaagtc tggccggggc aagaaacaca cagccttctc ttccaagggc
     2701 ctcagtgatg aagagtacga tgagtacaag agaatcagag aggagaggaa tggcaaatac
     2761 tcaatagagg aatacctcca agatagggac aaatactatg aagagcttgc cattgctaag
     2821 gccactgagg aggacttctg tgaggaggag gagatcaaaa tccgccagag aatcttccga
     2881 cccaccagga agcagcggaa agaggaaagg gccacgcttg ggcttgtcac aggatcggaa
     2941 atcagaaaga ggaatccaga tgactttaaa ccaaaaggaa aattgtgggc tgatgacaac
     3001 aggagcgtgg attacaatga gaggatagat tttgaggctc ccccgagtgt ttggtctagg
     3061 atagtcaact ttggcacagg ctggggattc tgggtttctc caagtctctt tataacttca
     3121 acacacgtca taccaaaagg aattactgat gcctttggag tgcccataaa ccaaatccaa
     3181 attcacaaat ctggagaatt ttgccgcttg cggtttccaa agccaattag accagacgtg
     3241 agtgggatga tcttggaaga gggcgcccct gaaggcactg ttgtgtctat tctcatcaaa
     3301 agaacaacag gggagctgat gcctcttgca gtcaggatgg ggactcatgc cacaatgaaa
     3361 atccaaggta gaacggtggg tggtcagatg ggtatgcttc tcactggctc aaatgctaaa
     3421 agcatggatc taggcacaac gccaggtgac tgcggatgtc catacatata caaaaggggc
     3481 aatgaccttg tggtcattgg ggtgcacact gcagcggctc gtggaggcaa cacggtcata
     3541 tgtgccacac agggaagtga aggtgaagcc actcttgaag gaggtgacaa caagggtacc
     3601 tattgtggag cccccatttt gggacctggc aacgcaccaa aattgagcac aaagacaaaa
     3661 ttctggagat cctctaacgc accgcttccc ccaggtactt atgaaccagc ataccttggt
     3721 gggagagacc cgcgcgtgaa gggaggccca tctctgcaac aagttatgag agaccaactt
     3781 aaacctttta cagagcccag agggaagcca ccaaacccaa atgtcttaga gtcagcaaag
     3841 aagactatca tcaatgttct ggaacaaacc attgaccccc ctcaaaagtg gtcatatgcc
     3901 caagcttgtg catccctcga caagacaacc tccagtggat acccgcacca cgtccggaag
     3961 aatgactatt ggagtggtga atccttcaca ggaaaacttg cagatcaggc ttcaaaagca
     4021 aatctcatgt atgaggaagg caagcacatg caaccagttt acaccgcagc actcaaagac
     4081 gagctcgtga aaactgacaa aatttatggc aaaatcaaga aaagactcct gtggggttct
     4141 gacctctcca caatgattcg atgcgccaga gcatttggtg gtctcatgga tgaattcaaa
     4201 gcaaattgta ttacactccc tatcagagtt ggcatgaata tgaatgaaga tggtcccata
     4261 atatttgaga aacactccag gtacaggtac cactatgatg ctgattactc ccgctgggac
     4321 tccacacaac agcgggcagt gctggaagcg gcacttgaaa tcatggtgag attttctgct
     4381 gagccacagc tggcacaaat agtggcagag gacctgctgt caccaagtgt ggttgatgtg
     4441 ggcgatttca aaatcgctat caatgaaggc ctaccatctg gcgtgccttg cacctcacaa
     4501 tggaattcta ttgcccactg gttacttacc ttgtgtgccc tttctgaagt gacaggatta
     4561 ggtcctgaca tcatacaagc caactccatg tactctttct atggtgatga tgagattgtg
     4621 agcacagaca taaaattgga cccagagaaa ttgaccgcaa aactcaaaga atatggcctt
     4681 aaacccactc ggcccgacaa aactgagggg ccgttggtga ttagtgagga cctgaatggg
     4741 ttgactttcc tccgccgaac agtcacccgt gatccagcag gttggtttgg aaagttggac
     4801 caaaactcca tcctcaggca gttgtactgg acaagaggac ccaaccatga agaccccagt
     4861 gagaccatga taccacacgc acaaagacct gtgcagctca tggcactact aggagaatcc
     4921 tccctacatg gaccctcatt ttacagcaag gttagcaaat tagtcatatc tgaacttaaa
     4981 gagggaggaa tggattttta tgtgcccaga caagagtcaa tgttcagatg gatgaggttc
     5041 tcagatctaa gcacatggga gggcgatcgc aatctggctc ccagttttgt gaatgaagat
     5101 ggcgtcgaat gacgccgctc catctaatga tggtgctgct ggtctcgtac cagagggcaa
     5161 taacgagacc cttcccctag aaccagttgc gggcgcagct atagccgcac ccgtcactgg
     5221 ccaaaataac ataattgacc cctggattag aacaaatttt gtgcaagcac caaatggaga
     5281 gttcacagtg tcacccagaa actctcctgg agaaatttta ttaaacttag agttgggccc
     5341 tgatttgaac ccttatttgg ctcatttgtc aaggatgtac aatgggtatg ctggtggagt
     5401 ggaagttcag gttctcctgg cagggaacgc gttcactgcc ggaaagatcc tcttcgccgc
     5461 cgtcccgcca aatttcccag tggaattctt aagcccagcc cagatcacaa tgctcccaca
     5521 tttaatagta gatgttagga ctcttgaacc aattatgatc ccactccctg atgttaggaa
     5581 tacattcttc cattatagta accagcctaa tagccgcatg agattagtgg ctatgctcta
     5641 taccccactc agatctaatg gctcaggtga tgatgtcttt accgtctctt gcagggtttt
     5701 gactaggcct actcctgatt ttgagttcac ttatttagtg ccaccttctg ttgaatctaa
     5761 aactaagcct ttttccttac ctattttaac cctttctgag ctcacaaatt cgaggttccc
     5821 agtccccatc gattcgcttt tcaccgccca gaataatgtg ttgcaggtgc agtgtcaaaa
     5881 tggcaggtgt acacttgatg gtgagttaca aggcacaacc cagttgctcc catctggcat
     5941 ctgtgcattc agaggacggg tgacagcaca aattaaccaa cgtgacaggt ggcacatgca
     6001 actgcaaaac ctcaatggta caacatatga cccaactgat gatgtgccag ccccgctggg
     6061 tacacctgac ttcaagggcg tcgtgtttgg gatggtaagc caaagaaatg tgggtaatga
     6121 tgcgcctggc tcaaccagag cccaacaggc gtgggtttca acctatagcc cccaatttgt
     6181 ccccaaatta ggttctgtca atcttagaat tagtgataat gatgatttcc aattccagcc
     6241 gacaaaattc acaccagtgg gcgtcaatga tgacgatgat ggccacccgt tcagacaatg
     6301 ggaactacca aactattcag gggagcttac attgaatatg aatcttgccc ccccagttgc
     6361 tccaaatttt cctggtgaac aattgttatt cttcagatct ttcgtgccat gctcaggagg
     6421 ttacaaccaa ggtattatag attgtcttat tccccaagaa tggatccaac acttctatca
     6481 ggaatcagca ccctcccagt cagacgtggc cctaatcagg tatgtcaacc ccgatacggg
     6541 acgtacactg tttgaagcaa aattgcacag atctggttac attactgtgg ctcactctgg
     6601 agactatcct cttgttgttc cggctaatgg acactttaga tttgattctt gggtaaatca
     6661 gttttactca ctcgccccaa tgggaactgg gaatgggcga aggagggctc agtaatggct
     6721 ggggctttca ttgcaggatt ggcaggcgac atgctcacgt catctgtggg ctcccttgtg
     6781 aacgcagggg caaacgccat caaccaaaag atagactttg aaaacaacaa acaactccag
     6841 tctgcttcct ttcagcatga taaagagatg ctccaagcgc aggtgagggc aaccaagcag
     6901 ctgcaatctg aaatgatagc cctaaaacag ggggttttgg ccgcaggcgg cttttccccc
     6961 actgatgcag caaggggatc cattggtgca cccatgacaa aggtgcttga ctggtctggc
     7021 actcgatact gggcgcccaa ttccacaaag acaactggct attcgggaca attcacctct
     7081 tcacctgtgc atatgtctag cccaaatgct ccacaatcaa aacctgcaaa gcctaggtct
     7141 ctagctcctt cctcttcttc tagtagtgtc tatagtatgt atactcaatc tactcattta
     7201 acatctggct cttctagtag tgcttcttct gcctccacaa aattgacaaa tttaagctct
     7261 ggctcctctc aaaacagaac agcagagtgg gtaaatcaac agagaagtct tagccctttc
     7321 atgagtggcg cgcttaacat ctcacatgtc acgccaccct caagtagggc ttccagttct
     7381 gggacggtct cgaccgtgcc caaggaagtt ttggactcct ggacgtctgc gtttaacaca
     7441 cacagacagc cgctcttcgc acacctcaga gtgagggggg agtcacgtgt ttagtgaaa
//