Typing tool

Complete norovirus genomes

KT779557  GII.3
 GII.P16

Length: 7,549 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6728
ORF3: 6728..7492
LOCUS       KT779557                7549 bp    RNA     linear   VRL 10-JAN-2019
DEFINITION  Norovirus GII isolate Hu/GII.P16-GII.3/Omsk/O1370/2012/RUS,
            complete genome.
ACCESSION   KT779557
VERSION     KT779557.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7549)
  AUTHORS   Zhirakovskaia,E., Tikunov,A., Tymentsev,A., Sokolov,S.,
            Sedelnikova,D. and Tikunova,N.
  TITLE     Changing pattern of prevalence and genetic diversity of rotavirus,
            norovirus, astrovirus, and bocavirus associated with childhood
            diarrhea in Asian Russia, 2009-2012
  JOURNAL   Infect. Genet. Evol. 67, 167-182 (2019)
   PUBMED   30414977
REFERENCE   2  (bases 1 to 7549)
  AUTHORS   Zhirakovskaya,E., Tikunov,A., Shlyakhtun,V. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2015) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7549
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.P16-GII.3/Omsk/O1370/2012/RUS"
                     /isolation_source="Homo sapiens; sex: M; age: 11 years"
                     /db_xref="taxon:122929"
                     /country="Russia: Omsk region"
                     /collection_date="May-2012"
                     /note="genotype: GII.P16-GII.3"
     gene            5..5101
                     /gene="POL"
                     /note="encodes p48, NTPase, p22, VPg, 3CLpro, RdRp"
     CDS             5..5101
                     /gene="POL"
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ANR02567.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQLAPRDNSQKPPRPPTPELVKRIPPPPPNGEEEEPVIRYEVKSGVSGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAV
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVE
                     KAKRDFPGQPDMWKDAFKPDFSHIRLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVIIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQVNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPPLDQNESEAKEEA
                     PKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEVKIRQRIFRPTRKQRKEERATLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNMPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPTVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFRVSINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     gene            5082..6728
                     /gene="VP1"
     CDS             5082..6728
                     /gene="VP1"
                     /note="ORF2; major viral capsid protein"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="ANR02568.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINNEAMALDPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKVIFAAIPPNFPTDNLSAAQITMCPHVIVDVRQLEPINLPMPD
                     VRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKIKPFTLPILTISEMSNSRFPVPIDSLHTSPTDNIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADAATPRLFNYHWHIQLDNLNGTPYDPAEDIPAP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTSGRFTPKLGSLEISTESGDFDQNQP
                     IRFTPVGIGVDNEADFQQWTLPDYSGQFTHNTNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGYMTIA
                     KSGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     gene            6728..7492
                     /gene="VP2"
     CDS             6728..7492
                     /gene="VP2"
                     /note="ORF3; minor viral capsid protein"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="ANR02569.1"
                     /translation="MAGAFIAGLAGDMLTNTVGSLVNAGAGAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQVDMIAIKQGVLTAGGFSPTDAARGAINAPITKVLDWSG
                     TRYWAPNATSTTSMSGGFTGQAVHRVTPNFKTNQAPKSTPSSGSSVSSSSTQLTNLSS
                     HSSGSSRSSGSTMVSSLPSSSRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSLD
                     TVSTVPKSVLDSWTSAFNTRRQPLFAHLRRRGESNI"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggcc cggcccaaac agcttgcccc gagggacaac tcacaaaagc ccccaagacc
      181 accaactccc gagttggtta agaggatacc ccctccccca cctaatggtg aagaagaaga
      241 accagtcatt aggtatgagg ttaagagtgg ggtctctggc ctgcccgagc tcacaacagt
      301 cccccagccg gatgtggcca acacggcatt cagtgtccca ccgctaagcc tgagagaaaa
      361 cagggaggcc aaggaaccgc tgacaggggc aatattagag atgtgggatg gagagatata
      421 tcactatggc ctgtacgtgg agaaaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 tgtaagcatg gcaaaagtgg agctgacgcc tttgtcgttg tactggcgtg tggtctacac
      541 cccccaatac ctcatctccc ctgaaactct caggaggctc aacggagagg cattccctta
      601 caccgccttt gacaacaact gctatgcctt ttgctgctgg gtattagacc tcaatgattc
      661 atggcttaac aggagaatgg tgcaaagaac aacaggcttc ttcagacctt accaagagtg
      721 gaacagaaaa cctctgccta ctatggatga ctccaaaatc aagaaggtgg caaacatatt
      781 cctgtgttca ttgtccacgt tgttcaccag acctataaaa gacctcatag gaaaaattaa
      841 accattaaat atcttgaaca tcctggcaac gtgtgactgg acattcgccg gaatagtgga
      901 gtctttgata ttactcgctg aactctttgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cccttacttg gagactacga gttgcaaggg ccagaagacc tcgccgttga
     1021 gctcgtgcct gtggtaatgg gagggattgg tctggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcatcaac gctcagggct tgtaaagatc ttggtgccta
     1141 tggcttagag atactcaaat tggtcatgaa gtggttcttc ccaaagaaag aagaggccaa
     1201 tgagctagcc atggtgagag ctatagagga tgctgtactg gatcttgagg caatagaaaa
     1261 caatcacatg acaactttgc tgaaagacaa agacagccta gcaacctaca tgaaaacact
     1321 ggacatggag gaggaaaaag ccagaagatt gtccacaaaa tctgcatccc ccgacatagt
     1381 tgggacgatc aacgccctgc tggctcgaat agcagcggct aggtcactag tccacagggc
     1441 caaggaggag ttatctagca ggatgagacc agtagttgtc atgatatctg gcaaaccagg
     1501 gataggaaaa actcatttgg ccagggaggt ggcaagaaag gtggcatcca ctctcacagg
     1561 ggatcaaaga gtcgggctca taccgagaaa tggtgtggac cattgggatg catataaagg
     1621 tgagagagtc gtgctgtggg acgactatgg catgagcaac cccattcatg atgctctgcg
     1681 catacaagaa ttggctgata cgtgtcccct taccttaaat tgtgacagaa ttgaaaataa
     1741 gggaaaagtt tttgacagtg aagtcataat aattacaaca aaccttgcca atccagcccc
     1801 acttgattat gtcaactttg aggcctgctc caggagaatt gacttcctgg tttacgccga
     1861 ggcaccagaa gtagaaaagg caaaacgaga ctttcctggt caaccagata tgtggaagga
     1921 cgccttcaag ccggactttt cacatatcag gttgcaactt gcacctcagg gcggctttga
     1981 caagaatggc aacaccccac atggaaaagg agtgatgaag accctcacca ccggttccct
     2041 gattgcccgt gcatcaggct tactgcatga gaggatggat gaatttgaac tccaaggccc
     2101 cacagtcacc accttcaatt tcgaccggaa cagaatcacc gcattcagac aattggctgc
     2161 agaaaacaag tatggattgg tggacaccat gagagttggc aatcaattaa aaggggtgaa
     2221 aaccatggaa gaactcaaac aagcaatcaa aaatgtgatc atcaagaggt gccggatcat
     2281 ctacggtggc tccacgtatg accttgaatc tgatggcaag ggcaaagttt tggtggaaaa
     2341 ggttaagaac acctctgtac aggtcaacaa cgagttggcc ggagccctgc atcacctcaa
     2401 acatgcccgg atcaggtact atgtcaaatg tgtgcaagaa gcagtctact ctatcataca
     2461 aattgccggc gctgcatttg tcaccacacg cattgcacgc cgcatgaaca tacaagagct
     2521 ttggtcgaag ccaccattag accaaaatga atcagaggct aaggaagagg cccccaagtc
     2581 agaagatgac gagttcatca tatcttctaa ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca agaaacacac tgcattctct agcaaaggct tgagcgatga
     2701 ggagtatgac gagtacaaga ggataagaga agagagaaat gggaagtact ctatagagga
     2761 gtatcttcaa gacagagaca ggtactatga ggaactcgcc atcgccaagg ccacggaaga
     2821 agacttctgt gaggaggagg aggtcaaaat ccgtcagagg atcttccgtc ccaccaggaa
     2881 acaaaggaag gaggagaggg ccacactagg gctagtaact ggttcagaaa tcagaaaaag
     2941 aaaccctgat gacttcaaac ctaaagggaa actgtgggcc gatgacaaca gaagtgttga
     3001 ctacaatgag aaactggact ttgaggcccc cccaagcata tggtctagga ttgtgagctt
     3061 tggttctggc tggggcttct gggtatcacc aagcctgttc ataacatcaa ctcatgtaat
     3121 tcctgcaggc ataacagagg catttggagt ccccatcaaa caaatccagg tccacaaatc
     3181 aggtgaattt tgccggttca gattcccaaa accaattagg ccagatgtga caggaatgat
     3241 cttggaagaa ggtgcgcctg agggtaccgt ggcaaccgtg ctcatcaaac gccctaccgg
     3301 agagctcatg ccccttgcag ccagaatggg gacacacgca accatgaaaa ttcaaggccg
     3361 tatggttggc ggacagatgg gtatgttgct cactggttca aatgctaaag gaatggattt
     3421 gggaacaact cctggtgatt gtggctgtcc ctacatctac aaaaggggca atgactatat
     3481 agtcattggg gtgcacacag cagcagcccg tggtggaaac accgtcatct gcgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacat actgtggggc
     3601 acccattcta ggccctggag gggcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacatg cctcttccac cagggacata tgagcctgcc tacctcggtg gccgtgaccc
     3721 gcgtgttaag ggtgggccct ccttgcagca ggtaatgaga gaccagttga agccattcac
     3781 tgagcccagg ggcaaacctc caagaccaac tgtgttggaa gcagccaaac aaaccatcat
     3841 caatgtcctc gaacaaaccc tggaccctcc acaaaaatgg acatacgcac aggcgtgtgc
     3901 ttcacttgac aaaaccacct ccagcgggca tccccaccac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gtaagttggc agaccaagca tcaaaagcaa acctaatgtt
     4021 tgaggaaggg aaacacatga caccagtgta tacagcagcc ctcaaggacg agctggtcaa
     4081 gactgacaaa gtctatggaa agatcaagaa gagactgctc tggggctctg atttgtccac
     4141 catgatccgg tgcgccaggt cctttggtgg gctcatggat gagatgaagg cacactgcat
     4201 atcactccca gtccgagttg gcatgaacat gaatgaagat ggtccaataa tatttgagaa
     4261 gcactccaga tacaagtacc actatgatgc agactactcc cgctgggatt caacacaaca
     4321 gagggcagta ttagcagcag ccttggaaat catggtcagg ttctctgcag agccacaatt
     4381 ggcacagata gtcgctgagg atctgttggc ccccagtgtg gtagatgtag gagactttag
     4441 agtttcaata aatgaagggc tcccctctgg tgtgccatgc acttctcagt ggaattccat
     4501 cgcacactgg ttgctaaccc tctgtgcctt gtctgaagtc accaaactgt cccctgacat
     4561 tgtacaggca aattccatgt tctcatttta cggtgatgac gagattgtca gcaccgatat
     4621 aaaattggac cctgaaaagt taaccaccaa attgaaggag tacggcctga agccaactcg
     4681 cccagacaaa accgagggac ccctgatcat cagtgaggat ttgaacggac tcactttcct
     4741 ccggaggacg gtgactcgtg acccagctgg ctggtttggg aaattggacc aaagttcaat
     4801 attgaggcag atgtactgga ctagaggacc aaatcatgag gaccccaatg agacaatgat
     4861 accccactct caaagaccca tacagctcat ggcactgctt ggtgaggcct cccttcacgg
     4921 accctctttc tacagcaaaa ttagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggacttttac gtgccaaggc aggaacccat gttcagatgg atgaggttct ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgaatg
     5101 acgctgctcc atctaatgat ggtgccgccg gcctcgtacc agagatcaat aatgaggcaa
     5161 tggcgctaga tccagtggcg ggcgcagcga tagcagcacc ccttactggt cagcaaaaca
     5221 taatagatcc ctggattatg aataattttg tgcaagcacc tggtggtgag tttacagtgt
     5281 cacctaggaa ctcccctggt gaagtacttc taaatttaga attaggccca gaaataaacc
     5341 cctacctggc gcatcttgct aggatgtaca atggttatgc aggtgggttt gaggtgcagg
     5401 tggtcctggc tggaaatgcg tttacagcag ggaaagtgat ctttgcagct atacccccca
     5461 atttcccaac tgacaatttg agtgcagcgc agattacaat gtgtcctcat gtaattgtag
     5521 atgtcaggca gttggaacca atcaacctcc cgatgcctga cgtccgcaac aatttcttcc
     5581 attataatca aggttctgat tcgaggttac gcttaattgc aatgttgtat actcccctta
     5641 gggcaaataa ttctggagat gatgttttca ctgtgtcatg tagggtgttg actaggccca
     5701 gtcctgactt ctcattcaat ttcctcgtcc cgcccactgt ggaatcaaag ataaaacctt
     5761 tcaccctccc tattttgacc atctctgaga tgtctaattc tagatttcca gtgccaattg
     5821 actctctgca caccagtcca actgataaca ttgttgtcca gtgccaaaat gggcgcgtca
     5881 cccttgatgg cgagctaatg ggcaccaccc aactcttgcc gagtcagata tgtgctttta
     5941 ggggtgtgct caccagatca acaagcaggg ccagtgatca agctgacgca gcaaccccta
     6001 gactcttcaa ctaccattgg cacatacaac tagacaacct aaatgggacc ccgtatgacc
     6061 ctgcagagga cataccagct cctctgggga cgccagactt tcggggcaaa gtctttggcg
     6121 tagccagcca gagaaaccct gacagcacaa caagggcaca tgaggcaaaa gtggatacaa
     6181 catctggccg cttcacccca aaattgggct ccctagaaat atccactgaa tctggtgact
     6241 ttgaccagaa tcaaccaata agattcaccc cagttggcat tggagttgac aatgaggcag
     6301 actttcaaca atggacctta cctgattatt ccggtcagtt cacccacaac acgaatctgg
     6361 ccccagctgt cgctcccaat tttcccggtg aacagcttct tttcttccgc tcacagttgc
     6421 catcctctgg cgggcggtcc aatggcattc tagactgcct ggtcccccag gaatgggtcc
     6481 aacacttcta ccaggaatcc gcccctgccc aaacgcaggt ggctctggtc aggtatgtca
     6541 accctgatac tggtagggtg ttatttgagg ctaagctgca taagctaggc tacatgacca
     6601 tagctaagag tggtgattct ccaataactg tacccccaaa tggatacttt aggtttgaat
     6661 cttgggtgaa tcccttttac acattagccc ccatgggaac tgggaatggg cgtagaagga
     6721 ttcaataatg gctggagcat ttatagcagg attggctggt gacatgctca caaacactgt
     6781 agggtcttta gttaatgcag gggctggtgc tattaatcaa aaagttgatt ttgaaaataa
     6841 taaatatcta caaaatgcat cctttaatca tgataaggag atgttaaatg cacaaattga
     6901 ggcaactaag aggctacagg ttgacatgat tgctatcaaa caaggggttt tgaccgctgg
     6961 cggtttctcc cccactgatg cagcccgtgg ggctattaac gcccccataa caaaagttct
     7021 ggactggagt ggaaccaggt actgggcacc aaatgccacc tccacaactt caatgtcagg
     7081 tggcttcaca ggtcaagctg tgcatagagt tacaccaaat tttaaaacca accaagcccc
     7141 aaaatccacg cccagcagtg ggtcttcagt gagttcaagc tcaacccaac tcaccaactt
     7201 gagctcacac tcatctgggt cttctcgatc cagcgggtcc acgatggtca gctcgttacc
     7261 atcttccagt aggactagag actgggttaa ccaacagaat tttaatttgg aaccacacat
     7321 gcctggatct ctcaggacag cttttgttac tccaccatct agtacagcct ctagcttaga
     7381 cacggtctca accgtgccca agagtgtttt ggactcctgg acatctgcgt ttaacacgcg
     7441 cagacagccg ctcttcgcac accttcgtag aaggggggag tcaaatattt agtgaaaaga
     7501 ttattcttaa atttggtttg taattggatt taaattagaa tcttttaaa
//