Typing tool

Complete norovirus genomes

KT202796  GII.4 Sydney
 GII.P31

Length: 7,513 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       KT202796                7513 bp    RNA     linear   VRL 12-NOV-2015
DEFINITION  Norovirus GII isolate Hu/Guangzhou/GZ2014-L132/CHN/2014, complete
            genome.
ACCESSION   KT202796
VERSION     KT202796.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7513)
  AUTHORS   Xue,L., Wu,Q., Cai,W., Kou,X., Zhang,J. and Guo,W.
  TITLE     Development of a sensitive method for directly sequencing GII.4
            Norovirus genome
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7513)
  AUTHORS   Xue,L., Wu,Q., Cai,W., Kou,X., Zhang,J. and Guo,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-2015) State Key Laboratory of Applied
            Microbiology Southern China, Guangdong Institute of Microbiology,
            No. 100, Xianliezhong Road, Yuexiu District, Guangzhou, Guangdong
            510070, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7513
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/Guangzhou/GZ2014-L132/CHN/2014"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China"
                     /collection_date="05-Mar-2014"
                     /note="genotype: GII.Pe_GII.4_Sydney2012"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ALM98909.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLMDTMRVGKQLKDVKTM
                     SDLKQALKNIAIKKCQIVYNGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMANKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGNEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6707
                     /gene="VP1"
     CDS             5085..6707
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ALM98910.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNTPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQDAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     gene            6707..7513
                     /gene="VP2"
     CDS             6707..7513
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="ALM98911.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGPSSKSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSFPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 catcgcaaaa tcttcaagtg acggtgtgtt ttctaacatg gctgtcactt ttaagcgggc
      121 cctcggggcg cggcctaaac agccgccccc gaaggaaata ccacccagac ccccgcgacc
      181 acccacacca gaattggtca aaaagatccc tcctccccca cccaacgggg aggatgaact
      241 agtggtctct tacagcgcca aagatggcgt ttccggactg cctgagctca ccactgtcag
      301 acaaccggaa gaaaccaaca cggcgttcag tgtcccccca ctcaaccaaa gagagagcag
      361 ggacgccaag gagccactaa ctggaacaat cattgaaatg tgggatggag aaatctacca
      421 ttacggcctg tacgtggaac gaggtcttat acttggtgtg cacaagccac cggcagccat
      481 tagccttgcc aaggtcgagc tagcaccgct ctctttgttc tggagacctg tgtacacccc
      541 ccagtatctc atctctccag acactcttag gagattacat ggagagtcat tcccctacac
      601 tgcatttgac aacaattgct acgccttttg ttgttgggta ttagacctaa acgactcatg
      661 gctaagcagg agaatgattc agagaacaac aggcttcttc aggccgtacc aggattggaa
      721 caggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcca acatattctt
      781 gtgcactttg tcttcactat tcaccagacc cattaaggac ataataggga agttgaaacc
      841 tcttaacatc cttaacattc tggccacatg tgattggacc ttcgcaggca tagtggaatc
      901 cttaatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttgctaggtg attatgaact gcaaggacct gaggaccttg cagtggaact
     1021 ggtcccaata gtgatggggg ggataggttt ggtgctagga tttaccaaag agaaaatcgg
     1081 aaagatgcta tcatccgctg catccacttt aagagcttgt aaagaccttg gtgcatacgg
     1141 actggaaatc ttaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtactagac ctcgaggcaa ttgaaaacaa
     1261 ccacatgacc accctactca aagacaaaga cagcttggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca gaaaactctc aaccaaatct gcttcacccg atattgtggg
     1381 cacaatcaac tctcttctgg caagaatcgc tgctgcacgc tccctagtgc atcgggcgaa
     1441 agaagagctc tccagcaggc cgagacctgt cgttgtgatg atatcgggaa gaccagggat
     1501 agggaagact caccttgcca gggagctggc caaaaagatc gcggcctccc tcacagggga
     1561 ccagcgtgtg ggtcttatcc cacgcaatgg tgtcgaccac tgggacgcat acaagggcga
     1621 aagagttgtc ctatgggacg actatggaat gagcaacccc atccatgatg ccctcaggtt
     1681 gcaggagctt gctgacactt gtcccctcac gctaaattgt gacagaattg agaacaaagg
     1741 gaaagtcttt gacagtgatg ccataattat caccaccaat ctggccaacc cagcaccact
     1801 ggattatgtc aactttgaag cgtgctcgag acgcattgat ttcctcgtgt acgcagaagc
     1861 ccctgaggtg gagaaggcaa agcgcgactt cccaggtcaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gacttctcac acataaaact gtcattggct ccacagggtg gttttgacaa
     1981 gaacggtaac accccgcatg gaaaaggggt catgaagacc ctcaccactg gctccctcat
     2041 cgcccgagca tcagggttac tccatgagag gctagatgaa tatgaactgc aaggcccagc
     2101 cctcaccact ttcaactttg accgcaacaa gatacttgct tttagacagc ttgctgctga
     2161 aaacaagtat gggctgatgg acacaatgag agttggaaaa cagctcaagg atgtcaagac
     2221 catgtcagac ctcaaacaag cactcaagaa catcgcgatc aagaagtgcc agatagtgta
     2281 caatggtggc acctacacac ttgaggctga tggcaagggt agtgtgaaag ttgacaaagt
     2341 gcaaagtgcc actgtgcaga ccaacaatga actagccggc gccctacacc acctaaggtg
     2401 cgctagaatc agatactatg ttaagtgcgt ccaggaggca ctgtattcca tcatccaaat
     2461 cgctggggct gcattcgtca ccacgcgcat cgctaagcgc atgaatatac agaatctctg
     2521 gtccaagcca caggtggaag acacagaaga gatggccaac aaagatggtt gcctaaaacc
     2581 caaagatgat gaagagtttg tcgtctcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaagaacaag tccggccgtg gcaagaagca cacagccttt tcaagtaaag ggctcagtga
     2701 tgaggagtac gatgagtaca agagaatcag agaagaaaga aatggtaagt actccataga
     2761 agagtacctt caggacagag acaggtacta cgaggaggtg gccattgcca gggcaaccga
     2821 agaggacttc tgtgaagaag aagaggccaa aatccggcag agaattttta gaccaacaag
     2881 gaaacaacga aaagaagaga gggcctctct cggcttggtc acaggctctg aaatcaggaa
     2941 gagaaaccca gaagacttca aacccaaggg aaagctgtgg gctgatgatg acagaagtgt
     3001 cgactacaat gagaaactca actttgaggc cccaccaagc atctggtcgc ggatagtcaa
     3061 ctttggttca ggctggggct tctgggtctc ccccagtctg tttataacat caacccatgt
     3121 cataccccaa ggtgcaaaag agttcttcgg agtccctatc aagcaaatcc agatacacaa
     3181 gtcgggtgaa ttctgccggt tgagattccc aaaaccaatc agaactgatg tgacgggcat
     3241 gattctagaa gaaggtgcgc ccgaggggac cgtggccaca ctgctcatca agagaccaac
     3301 tggagagctc atgcctctgg cagccagaat ggggacccat gcaaccatga agattcaggg
     3361 gcgcacagtt ggagggcaaa tgggcatgct cctgacagga tccaacgcca agagtatgga
     3421 cctaggcaca acaccaggcg actgcggctg cccctacatc tacaagagag ggaatgacta
     3481 cgtggtcata ggagtccata cggccgctgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaggggaat gagggagaag ccacacttga aggaggtgac agtaaaggga catactgtgg
     3601 cgcgccaatc ttgggcccag ggagtgctcc gaagctcagt accaagacta agttttggag
     3661 atcatccaca acaccactcc cacctggcac ctacgaacca gcctacctcg gtggtaaaga
     3721 ccctagagtc aaaggtggcc cttcattgca acaagttatg agggaccagc tgaagccatt
     3781 cacagaaccc agaggcaaac caccaagacc gaatgtgttg gaagctgcca agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgaccc accccaaaaa tggtcatttg cgcaagcttg
     3901 cgcatccctt gacaaaacca cctccagcgg ccacccgcat cacatgcgga aaaacgactg
     3961 ttggaatggg gagtccttca caggaaaatt ggctgatcaa gcctccaagg ccaacctaat
     4021 gtttgaagag ggaaagaaca tgactccagt ctacacaggt gcacttaaag atgagttggt
     4081 aaagaccgac aaagtttatg gtaaggtcaa gaagaggctt ctgtggggtt cagatctggc
     4141 gaccatgata cggtgcgccc gagcttttgg aggccttatg gatgaactca aggcacactg
     4201 tgtcacactt cctgtcagag ttggtatgaa catgaatgag gatggcccca tcatctttga
     4261 gaagcactcc agatatagat atcactatga tgctgattat tcccggtggg actcaacaca
     4321 acaaagggat gtgctagcag cagcactaga aatcatggtt aagttctctc cagaaccaca
     4381 cctggcccag atagttgcag aagacctcct ctcccctagc gtgatggatg taggcgactt
     4441 tcaaatatca ataagtgagg gtctcccctc tggggtgcct tgtacctccc agtggaattc
     4501 catcgcccac tggctcctca ctctgtgtgc actctctgaa gtcacggacc tgtcccctga
     4561 tatcattcag gccaactccc ttttctcctt ctatggtgat gatgaaattg taagcacaga
     4621 cataaagttg gacccagaga agctgacagc aaaactcaag gagtacgggc tgaaaccaac
     4681 ccgccccgac aaaactgaag gaccccttgt tatctctgaa gacctggatg gcctgacatt
     4741 cctccggaga actgtgaccc gtgatccagc tggctggttt ggaaaattgg aacaaagttc
     4801 aattctcagg caaatgtact ggaccagggg tcccaaccat gaagacccat ttgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt gatgtccttg ctgggcgagg ctgcactcca
     4921 cggcccggca ttctatagca aaattagcaa attagtcatt gcagagttga aggaaggtgg
     4981 catggatttt tacgtaccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggctct ggagcccgtt gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttgggc cctgatctaa
     5341 acccctacct atcccatttg gccagaatgt acaatggtta tgcaggtggc tttgaagtgc
     5401 aggtaattct cgcggggaac gcgttcaccg ccgggaaagt catatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagcccca gccaggtcac tatgttcccc catatagtag
     5521 tagatgttag gcaattagaa cctgtgttga ttcccttacc cgacgttagg aataatttct
     5581 atcattacaa tcaatcaaat gaccccacca ttaagttgat agcaatgttg tatacaccac
     5641 ttagggctaa taatgctggg gatgatgtct tcacagtttc ttgccgagtt ctcacgaggc
     5701 catcccccga ttttgatttc atatttctag tgccacccac agttgagtca agaactaaac
     5761 cattctctgt cccagtttta actgttgagg agatgaccaa ttcaagattc cccatccctt
     5821 tggaaaagtt gttcacgggt cccagcagtg cctttgttgt ccaaccacaa aacggtaggt
     5881 gcacgactga tggcgtgctc ctaggcacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagaggaga tgtcacccat atcacaggta gtcgtaacta cacaatgaat ttggcttctc
     6001 aaaattggag caattatgac ccaacagaag aaatcccagc ccctctagga actccagact
     6061 ttgtggggaa gattcaaggc gtgctcaccc aaaccacaag gacagatggc tcaacacgcg
     6121 gccacaaagc cacagtgtac actgggagcg ctgactttgc tccaaaactg ggtagagttc
     6181 aatttgaaac tgacacagac catgattttg aagctaacca aaacacaaag ttcaccccag
     6241 ttggtgtcat ccaagatggt ggcaccaccc accgaaatga accccaacag tgggtgcttc
     6301 caagttactc aggcagaaat actcctaatg tgcatttggc ccccgctgta gcccccactt
     6361 ttccgggtga gcaacttctt tttttcagat ccaccatgcc cggatgcagc gggtacccca
     6421 acatggactt ggactgcctg ctcccccagg aatgggtgca gtacttctac caagacgcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggttatttta ggtttgattc ctgggtcaac cagttctaca
     6661 cgcttgcccc catgggaaat ggaacggggc gtagacgtgc actataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctta tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgagtt tgaaaataac agaaaattgc aacaagcatc
     6841 cttccaattt agcagcaacc tacaacaggc ttcctttcaa catgacaaag agatgctcca
     6901 agcacaaatt gaggccacca aaaggctaca acaggaaatg atgaaagtta agcaggcaat
     6961 gctcctagaa ggtgggtttt ctgagacaga tgcagcccgc ggggcaatca acgcccccat
     7021 gacaaaagct ttggactgga gcgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ctacccctca accatcgggg gcactgccag gaagagctaa
     7141 tcttagggat gctgtccctg ctcggggtcc ctccagtaag tcttctaatt cttccactgc
     7201 tacttctgtg tactcaaatc aaactacttc aacgagactt ggttctacag ctggttctgg
     7261 caccagtgtc tcgagcttcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagagattt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc actcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taa
//