Typing tool

Complete norovirus genomes

KT152148  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,564 | 3 CDS

ORF1: 6..5105
ORF2: 5086..6708
ORF3: 6708..7514
LOCUS       KT152148                7564 bp    RNA     linear   VRL 19-SEP-2018
DEFINITION  Norovirus Hu/GII.P4_GII.4/Minerva/2006/USA, complete genome.
ACCESSION   KT152148
VERSION     KT152148.1
DBLINK      BioProject: PRJNA490509
            BioSample: SAMN10039973
KEYWORDS    .
SOURCE      Norovirus Hu/GII.P4_GII.4/Minerva/2006/USA
  ORGANISM  Norovirus Hu/GII.P4_GII.4/Minerva/2006/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7564)
  AUTHORS   Yang,Z., Mammel,M.K. and Kulka,M.
  TITLE     Complete Genome Sequence of Human Norovirus GII.4_2006b, a Variant
            of Minerva 2006
  JOURNAL   Genome Announc 4 (1), e01648-15 (2016)
   PUBMED   26823589
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7564)
  AUTHORS   Yang,Z. and Kulka,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUN-2015) Molecular Virology Team/Division of
            Molecular Biology/OARSA/CFSAN, Food and Drug Administration, 8301
            Muirkirk Road, Laurel, MD 20708, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 8.0.1
            Coverage              :: 3437 X
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7564
                     /organism="Norovirus Hu/GII.P4_GII.4/Minerva/2006/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P4_GII.4/Minerva/2006/USA"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1703222"
                     /country="USA"
                     /collection_date="2006"
                     /note="genotype: GII.P4_GII.4"
     5'UTR           1..5
     CDS             6..5105
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structrual polyprotein"
                     /protein_id="ALA27426.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSNMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPLPPPNGEDEVVVSYSAKGGISGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVEQGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTTDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMITPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALYHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5086..6708
                     /note="ORF2"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ALA27427.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNVHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6708..7514
                     /note="ORF3"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="ALA27428.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRINPRAPTPARGSSSAPS
                     NASTATSIYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
     3'UTR           7515..7564
ORIGIN      
        1 cgtgaatgaa gatggcgtct aacgacgctt ccgctgccgc tgttgctaac agcaacaacg
       61 acaccgcaaa atcttcaagt gacaaaatgt tttctaacat ggctgtcact tttaaacgag
      121 ccctcggggc gcggcctaaa cagccccccc cgagggaaat accacaaaga cccccacgac
      181 cacctactcc agaactggtc aaaaagatcc ctcttccccc gcccaacgga gaggatgaag
      241 tagtggtttc ttatagtgcc aaaggtggca tttccggttt acctgagctt tccaccgtca
      301 gacaaccaga agaaaccaat acggccttca gtgtccctcc actcaatcag agggagaata
      361 gggatgctaa ggaaccactg actggaacaa ttctggaaat gtgggatgga gaaatctacc
      421 attatggcct gtatgttgag caaggtcttg tgctgggtgt gcacaaacca ccagctgcca
      481 ttagcctcgc caaggtcgaa ctaacaccac tctccttgtt ctggagacct gtgtacactc
      541 ctcagtacct catctctcca gacactctca agaaattaca cggagaaaca tttccctaca
      601 cagcctttga caacaattgc tatgcctttt gttgctgggt cctggaccta aacgactcgt
      661 ggctgagtag gagaatgatc cagagaacaa ctggcttctt cagaccctac caagattgga
      721 ataggaaacc cctccctact acggatgatt ccaaattaaa gaaggtagct aacatattcc
      781 tgtgcaccct gtcttcgcta ttcaccaggc ccataaaaga cataatagga aagttaaggc
      841 ctctcaacat catcaacatc ctggcttcat gtgattggac tttcgcaggc atagtggagt
      901 ccttgatact cttggcagag ctctttggag tcttctggac acccccagat gtgtctgcga
      961 tgattacccc cttactcggt gatttcgagt tacaaggacc tgaggacctt gtagtggagc
     1021 tcgtccctgt agtaatgggg gggattggtt tggtgctagg attcaccaaa gagaagattg
     1081 gaaaaatgtt gtcatctgct gcatccacct tgagagcttg taaagatctt ggtgcatatg
     1141 ggctagagat cctaaagtta gtcatgaagt ggttcttccc gaagaaagag gaggcaaatg
     1201 aactggctat ggtgagatcc atcgaggatg cagtactgga ccttgaggca attgaaaaca
     1261 accatatgac caccttgctc aaagacaaag acagcctggc aacctacatg agaacccttg
     1321 acctcgagga agagaaagcc agaaaactct caaccaagtc tgcttcacct gacatcgtgg
     1381 gcacaatcaa cgcccttctg gcgagaatcg ccgctgcacg ctccctggtg caccgagcga
     1441 aggaggagct ttccagcaga ccaagacctg tagtcttgat gatatcaggc agaccaggga
     1501 tagggaagac ccaccttgct agggaagtgg ctaagagaat cgcagcctcc ctcacaggag
     1561 accagcgtgt aggcctcatc ccacgcaatg gcgtcgatca ctgggatgcg tacaaggggg
     1621 agagggtcgt cctatgggac gactatggaa tgagcaatcc catccacgac gccctcaggc
     1681 tgcaagaact cgctgacact tgccccctca ctctaaattg tgacaggatt gagaataaag
     1741 gaaaggtctt tgacagcgat gtcatcatta tcactactaa tctggccaac ccagcaccac
     1801 tggactacgt caactttgaa gcgtgctcga gacgcatcga cttcctcgtg tatgcagaag
     1861 cccccgaggt cgaaaaggcg aagcgtgact tcccgggcca acctgacatg tggaaaaacg
     1921 cttttagttc tgatttctca cacataaaat tggcactggc tccacaaggt ggctttgata
     1981 agaacgggaa caccccacac gggaagggcg tcatgaagac tctcaccact ggctccctca
     2041 ttgcccgggc atcagggctg ctccatgaga gattggatga gtttgaacta cagggcccag
     2101 ctcttaccac cttcaacttt gaccgcaaca aagtgcttgc cttcaggcag cttgctgctg
     2161 aaaacaaata tgggttgatg gacacaatga aagttgggag gcagctcaag gatgtcaaaa
     2221 ccatgccaga acttaaacaa gcactcaaga atatctcaat caagaagtgc cagattgtgt
     2281 acagtggttg cacctacaca cttgagtctg atggcaaggg caatgtgaaa gttgacagag
     2341 ttcagagcac ctccgtacag accaacaatg agctggctgg cgccctgtac catctaaggt
     2401 gtgccagaat caggtactat gtcaagtgtg tccaggaggc cctgtattct atcatccaga
     2461 ttgctggggc tgcatttgtc accacacgca tcatcaaacg tgtgaacatt caagacttat
     2521 ggtccaagcc acaagtggaa aacacagagg aggctaccaa caaggacggg tgcccaaaac
     2581 ccaaagatga tgaggagttc gtcatttcat ctgacgacat taaaactgag ggtaagaaag
     2641 ggaagaacaa gactggccgt ggcaagaagc acacagcctt ctcaagtaaa ggtctcagtg
     2701 atgaagagta tgatgagtac aagagaatta gagaggaaag gaatggcaag tactccatag
     2761 aagaatacct tcaggacagg gacaaatact atgaggaggt ggccattgcc agggcgaccg
     2821 aggaagactt ctgtgaagag gaggaggcca agatccggca aaggatcttc agaccaacaa
     2881 ggaaacaacg caaggaagaa agagcttctc tcggtttagt cacaggttct gaaattagga
     2941 aaagaaaccc agaagacttc aagcccaagg ggaaactatg ggctgacgat gacagaagtg
     3001 tggactacaa tgagaaactc agttttgagg ccccgccaag catctggtca aggatagtca
     3061 actttggctc aggttggggc ttctgggtct cccccagcct gttcataaca tcaacccacg
     3121 tcatacccca gggcgcaaag gagttctttg gagtccccat caaacaaatt caggtacaca
     3181 agtcaggcga attctgtcgc ttgaggttcc caaaaccaat caggactgat gtgactggca
     3241 tgatcttgga agaaggtgcg cccgaaggca ccgtggccac actactcatc aaaaggtcta
     3301 ctggagaact catgccccta gcagctagaa tggggaccca tgcaaccatg aaaattcaag
     3361 ggcgcactgt tggaggtcag atgggcatgc ttctgacagg atctaacgcc aaaagcatgg
     3421 atctaggcac cacaccaggt gattgcggct gtccctacat ctacaagaga ggaaatgact
     3481 atgtggtcat tggagtccac acggctgccg ctcgtggggg aaacactgtc atatgtgcca
     3541 cccagggggg tgagggggaa gctacacttg aaggtggtga cagtaaggga acatactgtg
     3601 gtgcaccaat cctaggccca gggagcgccc caaaacttag caccaaaacc aaattctgga
     3661 gatcatccac agcaccactc ccacctggca cctatgaacc agcctacctt ggtggcaagg
     3721 accccagagt caagggtggc ccctcgttgc agcaagtcat gagggaccag ctgaaaccat
     3781 ttacagagcc caggggtaag ccaccgaagc caagtgtgtt agaagctgcc aagaaaacca
     3841 tcatcaatgt ccttgaacaa acaattgacc cacctgagaa gtggtcgttc gcacaagctt
     3901 gcgcgtccct tgacaagacc acttctagcg gccacccgca ccacatgcgg aaaaacgact
     3961 gctggaacgg ggagtccttc acaggcaagc tggcagacca ggcttccaag gccaacctga
     4021 tgtttgaaga agggaagaac atgaccccag tttacacagg tgcacttaag gatgaattag
     4081 tcaaaactga caaaatttat ggtaagatca agaagaggct tctctggggc tcggacttag
     4141 caaccatgat ccggtgtgct cgagcattcg gaggcctaat ggatgaactc aaagcacact
     4201 gtgtcacact tcctatcaga gttggtatga atatgaatga ggatggcccc atcatcttcg
     4261 agaagcattc caggtacaga taccactatg atgctgatta ctctcggtgg gattcaacac
     4321 aacagagagc cgtgctggca gctgctctgg aaatcatggt taaattctcc tcagaaccac
     4381 atttggctca ggtagtcgca gaagaccttc tttctcctag cgtggtggat gtgggtgact
     4441 tcacaatatc aatcaacgag ggtcttccct ctggggtgcc ctgcacctcc caatggaact
     4501 ccatcgccca ctggcttctc actctctgtg cactctccga agttacaaat ttgtccccag
     4561 acatcataca ggctaattct ctcttctcct tctatggtga tgatgaaatt gttagtacag
     4621 acataaaact agacccagag aagttgacag caaagcttaa ggaatatggg ttgaaaccaa
     4681 cccgccctga taaaactgaa ggacctcttg ttatttctga agacttagat ggtttgactt
     4741 tcctgcggag aactgtgacc cgcgacccag ccggttggtt tggaaaactg gagcagagct
     4801 caatactcag gcaaatgtac tggactaggg gccccaacca tgaagatcca tctgaatcaa
     4861 tgattccaca ctctcagaga cccatacaat tgatgtcctt actgggagag gccgcactcc
     4921 acggcccaac attctacagt aaaatcagca aattagtcat tgcagaacta aaagaaggtg
     4981 gtatggattt ttacgtgccc aggcaagagc caatgttcag atggatgaga ttctcagatc
     5041 tgagcacgtg ggagggcgat cgcaatctgg ctcccagttt tgtgaatgaa gatggcgtcg
     5101 aatgacgcca acccatctga tgggtccgca gccaacctcg tcccagaggt caacaatgag
     5161 gttatggctt tggagcccgt tgtcggtgcc gctattgcgg cgcctgtagc gggccaacaa
     5221 aatgtaattg acccctggat tagaaataat tttgtacaag cccctggtgg agagttcaca
     5281 gtgtccccta gaaacgctcc aggtgaaata ctgtggagcg cgcccttagg ccctgatctg
     5341 aatccctacc tatctcattt ggccagaatg tataatggtt atgcaggtgg ttttgaagtg
     5401 caagtgatcc tcgcggggaa cgcgttcacc gccggaaaaa ttatatttgc agcagtccca
     5461 ccaaattttc caactgaagg cttgagcccc agccaggtca ctatgttccc ccacataata
     5521 gtagatgtta ggcaattgga acctgtgttg atccccttac ctgatgttag gaataacttc
     5581 tatcattata atcagtcaaa tgattctacc attaaattga tagcaatgct gtatacacca
     5641 cttagggcta ataatgctgg ggaagatgtc ttcacagtct cttgccgagt cctcacgagg
     5701 ccatcccctg attttgattt catatttttg gtgccaccta cagttgagtc aagaactaaa
     5761 ccatttactg tcccaatctt aactgttgaa gagatgacca attcaagatt ccccattcct
     5821 ttggaaaagt tgttcacggg tcccagcggt gcctttgttg ttcaaccaca aaatggcaga
     5881 tgcacgactg atggcgtgct cttaggcacc acccaactgt ctcctgtcaa catctgcacc
     5941 ttcagagggg atgtcactca cattgcaggt tctcgtaatt acacaatgaa tttggcttct
     6001 ctaaattgga acaattatga cccaacagaa gaaattccag cccctctagg aactccagat
     6061 ttcgtgggaa agatccaagg tgtgctcact caaaccacaa agggagatgg ctcgacccgt
     6121 ggccataaag ctacagttta cactgggagt gcccccttta ctccaaagct gggcagtgtt
     6181 caattcagta ctgatacaga aaatgatttt gaaactcacc aaaacacaaa attcacccca
     6241 gtcggtgtca tccaggatgg tagcaccacc caccgaaatg aaccccaaca atgggtgctc
     6301 ccaagttatt caggtagaaa tgtccataat gtacacctag cccctgctgt agcccccact
     6361 tttccgggtg aacaacttct tttcttcagg tccactatgc ccggatgcag cgggtatccc
     6421 aacatggatt tggattgcct actcccccag gagtgggtgc agcacttcta ccaagaggca
     6481 gctccagcac aatctgatgt ggctctattg agatttgtaa atccagacac gggtagggtc
     6541 ctgtttgagt gcaaacttca taaatcaggc tatgtcacag tggctcacac cggccagcat
     6601 gatttggtca tcccccccaa tggctatttt aggtttgatt cctgggttaa tcaattctac
     6661 acacttgccc ccatgggaaa tggaacgggg cgtagacgtg ctttataatg gctggagctt
     6721 tctttgctgg attggcatct gatgtccttg gctctggact tggttctcta atcaacgctg
     6781 gggctggggc tatcaaccaa aagattgatt ttgaaaataa cagaaaattg cagcaagctt
     6841 ccttccagtt tagcagtaat ctacaacagg cttcctttca acatgacaaa gagatgctcc
     6901 aagcacaaat tgaggccact aaaaagttgc aacaggaaat gatgaaagtc aaacaggcaa
     6961 tgctcttaga aggtggattc tctgaaacag atgcagcccg tggggcaatc aatgccccca
     7021 tgacaaaggc tttggactgg agcggaacaa ggtactgggc ccctgatgct aggactacaa
     7081 catacaatgc aggccgcttt tccacccctc aaccttcggg ggcactgcca ggaagaatca
     7141 atcccagggc tcctaccccc gctcggggct cctctagcgc accttctaat gcttctactg
     7201 ctacttctat atattcaaat caaactgttt caacgagact tggttctaca gctggttctg
     7261 gcaccaatgt ctcgagtctc ccgtcaactg caagaactag gagttgggtt gaggatcaaa
     7321 acagaaattt gtcacctttc atgagggggg ctcacaacat atcgtttgtc accccaccat
     7381 ctagcagatc ctctagccaa ggcacagtct caaccgtgcc taaagaagtt ttggactcct
     7441 ggactggcgc tttcaacacg cgcaggcagc ctctcttcgc tcacattcgt aggcgagggg
     7501 agtcacgggt gtaatgtgaa aagacaaaat tgattatctt tccttttctt tagtgtcttt
     7561 taaa
//