Typing tool

Complete norovirus genomes

KR154230  GII.17
 GII.P17

Length: 7,552 | 3 CDS

ORF1: 1..5103
ORF2: 5084..6706
ORF3: 6706..7485
LOCUS       KR154230                7552 bp    RNA     linear   VRL 04-OCT-2015
DEFINITION  Norovirus Hu/GII.17/CGMH69/2015/TW nonstructural polyprotein
            (ORF1), capsid protein (VP1), and minor capsid protein (VP2) genes,
            complete cds.
ACCESSION   KR154230
VERSION     KR154230.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.17/CGMH69/2015/TW
  ORGANISM  Norovirus Hu/GII.17/CGMH69/2015/TW
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7552)
  AUTHORS   Lee,C.C., Feng,Y., Chen,S.Y., Tsai,C.N., Lai,M.W. and Chiu,C.H.
  TITLE     Emerging Norovirus GII.17 in Taiwan
  JOURNAL   Clin. Infect. Dis. (2015) In press
   PUBMED   26306886
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 7552)
  AUTHORS   Lee,C.C., Wang,W.L., Chen,S.Y., Tsai,C.N. and Chiu,C.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-APR-2015) Graduate Institute of Clinical Medical
            Science, College of Medicine, Chang Gung University, 259, Wen-Hwa
            1st Road, Kwei-Shan, Taoyuan County 333, Taiwan R.O.C.
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7552
                     /organism="Norovirus Hu/GII.17/CGMH69/2015/TW"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.17/CGMH69/2015/TW"
                     /isolation_source="fecal"
                     /host="Homo sapiens"
                     /db_xref="taxon:1729654"
                     /country="Taiwan"
                     /collection_date="2015"
                     /note="genotype: GII.17"
     gene            1..5103
                     /gene="ORF1"
     CDS             1..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ALG05456.1"
                     /translation="MVSNDASAAVAGKNNNNDKEKSSSDSLLANMSVTFKKALGARSK
                     QPPPGETKQIQKPPRPPTPELVKRVPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVVQP
                     DAQNTAYSVPPLGQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPAAI
                     SLAKIEITPLSLYWRVVYTPQYLIAPGTLKNLSGETFPYTAFDNNCYAFCCWVLDLND
                     SWLSRRMIQRTTGFFKPYQDWNRKPLPTMDEPKIKKAANAVLCALSSLFTRPIKDIIG
                     KLRPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLS
                     TKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLARE
                     LAKKVASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELADT
                     CPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDIE
                     KAKRDFPGQPDMWKDHFRPDFSHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLIAR
                     ASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSVKT
                     LDELKQAIKNISIKKCQIVYNGCTYTMESDGRGKVVVEKVQNATVQTNNELVGALHHL
                     RSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIARRMNISNLWSKPPIEEGDEPEDRGG
                     CPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERN
                     GKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGL
                     VTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFWVS
                     PSLFITSTHVIPKGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGAPE
                     GTVVSILIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDLVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPTL
                     GPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTE
                     PRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKNDY
                     WSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKTDKIYGKIKKRLLWGSD
                     LSTMIRCARAFGGLMDEFKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRW
                     DSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPERLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWTRG
                     PNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVPRQ
                     ESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5084..6706
                     /gene="VP1"
     CDS             5084..6706
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ALG05457.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELSPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLPSGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
                     VSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
                     DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
                     CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV
                     VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     gene            6706..7485
                     /gene="VP2"
     CDS             6706..7485
                     /gene="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="ALG05458.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNEQLQSA
                     SFQHDKEMLQAQVKATKQLQSEMIALKQGVLAAGGFSPTDAARGAIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVHMSSPNAPQSKPAKPRSLAPSSSSSSVYSTYTQSA
                     HLTSGSSSNASSASTKLTNLSFGSSLNRTAEGVNQQRSFSPFMRGALSISHVPPPPSR
                     ASSFGTVSPVPKEVLDSWTFAFNTHRQPLFPPLRVRGGSRV"
ORIGIN      
        1 atggtgtcta acgacgcttc cgctgccgtt gctggcaaaa acaacaacaa cgacaaggaa
       61 aaatcttcaa gtgacagctt gcttgctaac atgtctgtta cttttaagaa agccctcggg
      121 gcgcggtcta aacaaccgcc cccgggagaa acaaaacaaa tacaaaaacc accaaggcca
      181 ccgacaccgg aattggtgaa gagagtacct ccacccccac ctaatggcga ggatgaacca
      241 gggatagtgt acaaggtggg agagggtgtg tctgggctgc ccgacctaac aactgtggta
      301 caacctgacg cacaaaacac agcttatagt gttcccccac ttggccagag agaagtcggc
      361 gaagctaaag aaccgctgcc tggctccatt ttggaaatgt gggatggtga gatctaccac
      421 tatgggctgt atgttgagcg ggggcatgtg ctcggagtac acaaaccacc tgctgcaata
      481 agccttgcca aaattgaaat aacaccgctg tctctctact ggagagtggt ctacactccc
      541 cagtacttga tagctccagg aactcttaag aacttgagtg gagagacttt cccatacacg
      601 gcctttgaca acaactgtta tgccttctgt tgttgggtcc tagacctcaa cgactcctgg
      661 cttagcagga gaatgatcca aagaacaact ggattcttca aaccttacca ggattggaac
      721 agaaaaccct taccaaccat ggatgaaccg aaaatcaaga aggccgcgaa tgctgttcta
      781 tgcgctctct cctcactctt cactagaccc attaaggaca tcattggaaa gcttagacca
      841 ctgaacattc ttaatatact ggcaacctgc gattggactt ttgcaggcat agtggaatcc
      901 ttgattcttc ttgctgaact ctttggggtg ttctggacac ccccagatgt gtctgcgatg
      961 attgctccct tactcggtga ctacgagatg caaggccccg aagacctggc cgtggaactt
     1021 gtgcccgtgg taatgggagg aataggtttg gtgttaggat tcaccaaaga aaagatcggc
     1081 aagatgcttt catcagctgc gaccacactt agggcctgca aggatctagg atcttatgga
     1141 ttggagatac tcaaattggt catgaagtgg ttcttcccca agaaggagga ggctaacgaa
     1201 ctagccatgg tgagggccat tgaggatgca gtcctggatt tggaggcaat agaaaacaat
     1261 cacatgacca cccttctcaa ggataaagac agcctggcca catacatgag gactcttgac
     1321 ttggaagaag agaaagcaag gaaactgtca accaaatcgg cgtcacctga catcgtgggt
     1381 acaataaacg cattattggc taggatagca gccgccaggt cactggtcca caaggctaag
     1441 gaggagctct cgagcagaca gagacctgtt gttgtaatga tatcaggtag accaggtata
     1501 ggaaagaccc acctggccag agagctagcc aagaaagttg cgtcaacact gtcaggcgac
     1561 caaaggattg gactggtacc tagaaatggc gtcgaccatt gggacgccta caagggagaa
     1621 agggtggttc tgtgggatga ttatggtatg agcaacccta tacaggacgc actgaggctc
     1681 caagaattgg ctgacacctg ccctctgacc ctaaattgtg acaggattga aaacaaagga
     1741 aaagtgttcg acagtgatgc cataattata acaaccaacc ttgcaaaccc agcaccacta
     1801 gactatgtca actttgaggc ctgctctaga cgcatagact tcttggtgta tgcagacgca
     1861 cctgacattg agaaggctaa gcgtgacttc cctggccaac cagatatgtg gaaagaccat
     1921 ttcagaccag acttctcaca cattaaactt cagctggcac cacagggagg ttttgacaaa
     1981 aatggcaaca ccccacatgg caaaggtgtg gtgaagtccc tgacgattgg ttctctgatc
     2041 gccagggcct ctggcttgct ccacgagaga atggatgaat tcgagctcca aggctctgac
     2101 ctgccaacct tcaattttga ccgcaacaaa gtcgccgcct tcagacaatt agcagctgaa
     2161 aacaaatatg gtcttatgga cacactgagg gtcggcaacc aactgaaaag tgttaagacc
     2221 ctggatgagc tgaagcaggc cataaagaac atcagtatca agaagtgtca gatagtgtat
     2281 aatggatgca cctataccat ggaatctgat gggaggggca aggttgtggt tgaaaaggta
     2341 caaaacgcaa cagttcaaac caacaatgaa cttgtagggg cgctccacca cctgagatct
     2401 gcaaggataa gatactatgt taaatgtttc caagaagcca tttactctct actccaaatt
     2461 gctggtgcag ccttcgtcac ctcacgcatc gcgaggcgca tgaacatatc aaacctctgg
     2521 tcgaagccac ccatcgagga gggtgatgag cctgaagaca gaggaggatg ccccaagccc
     2581 agggatgaag atgacctcac tattgactct agagacatta aagtggaagg gaagaagggc
     2641 aagaacaagt ctggccgggg caagaaacac acagccttct cttccaaggg cctcagtgat
     2701 gaagagtacg atgagtacaa gagaatcaga gaggagagga atggcaaata ctcaatagag
     2761 gaatacctcc aagataggga cagatactat gaagagcttg ccattgctaa ggccactgag
     2821 gaggacttct gtgaggagga ggagatcaaa atccgccaga gaatcttccg acccaccagg
     2881 aagcagcgga aagaggaaag ggccacgctt gggcttgtca caggatcgga aatcagaaag
     2941 aggaatccag atgactttaa accaaaagga aaattgtggg ctgatgacaa caggagcgtg
     3001 gattacaatg agaggataga ttttgaggct cccccgagtg tttggtctag gatagtcaac
     3061 tttggcacag gctggggatt ctgggtctct ccaagtctct ttataacttc aacacacgtc
     3121 ataccaaaag gaatcactga ggcctttgga gtgcccataa accaaatcca aattcacaaa
     3181 tctggagaat tttgccgctt gcggtttcca aagccaatta gaccagacgt gagtgggatg
     3241 atcttggaag agggtgcccc tgaaggcact gttgtgtcta ttctcatcaa aaggacaaca
     3301 ggggagctga tgcctcttgc agtcagaatg gggactcacg ccacaatgaa aatccaaggt
     3361 agaacggtgg gtggtcagat gggtatgctc ctcactggct caaatgctaa aagcatggat
     3421 ctaggcacaa cgccaggtga ctgcggatgt ccatacatat acaaaagggg caatgacctt
     3481 gtggtcattg gggtgcacac tgcagcagct cgtggtggca acacggtcat atgtgccaca
     3541 cagggaagtg aaggtgaagc cactcttgaa ggaggtgaca acaagggtac ctattgtgga
     3601 gcccccactt tgggacctgg caatgcacca aaattaagta caaagacaaa gttctggaga
     3661 tcctctaacg caccgcttcc cccaggtact tatgaaccag cataccttgg tgggagagac
     3721 ccgcgcgtga agggaggccc atctctgcaa caagttatga gagaccaact taaacctttt
     3781 acagagccca gagggaagcc accaaaccca aatgtcttag agtcagcaaa gaagactatc
     3841 atcaatgttc tggaacaaac cattgacccc cctcaaaagt ggtcatatgc ccaagcttgt
     3901 gcatccctcg acaagacaac ctccagtgga tacccgcacc acgtccggaa gaatgactat
     3961 tggagtggtg aatccttcac aggaaaactt gcagatcagg cttcaaaagc aaatctcatg
     4021 tatgaggaag gcaagcacat gcaaccagtt tacaccgcag cactcaaaga cgagctcgtg
     4081 aaaactgaca aaatttatgg caaaatcaag aaaagactcc tgtggggttc tgacctctcc
     4141 acaatgattc gatgcgccag agcatttggt ggtctcatgg atgaattcaa agcaaattgt
     4201 attacactcc ccatcagagt tggtatgaat atgaacgaag atggtcccat aatatttgag
     4261 aaacactcca ggtacaggta ccactatgat gctgattact cccgctggga ctccacacaa
     4321 cagcgggcag tgctggaagc ggcacttgaa atcatggtga gattttctgc tgagccacag
     4381 ctggcacaaa tagtggcaga ggacctgctg tcaccaagtg tggttgatgt gggcgatttc
     4441 aaaatcgcta tcaatgaagg cctaccatct ggcgtgcctt gcacctcaca atggaattct
     4501 attgcccact ggttacttac cttgtgtgcc ctttctgaag tgacaggatt aggtcctgac
     4561 atcatacaag ctaactccat gtactctttc tatggtgatg atgagattgt gagcacagac
     4621 ataaaattgg acccagagag attgaccgca aagctcaaag aatatggcct taaacccact
     4681 cggcccgaca aaactgaggg gccgttggtg attagtgagg acctgaatgg gttgactttc
     4741 ctccgccgaa cagtcacccg tgatccagca ggttggtttg gaaagttgga ccaaaactcc
     4801 atcctcaggc agttgtactg gacaagagga cccaaccatg aagaccccag tgagaccatg
     4861 ataccacacg cacaaagacc tgtgcagctc atggcactac taggagaatc ctccctacat
     4921 ggaccctcat tttacagcaa ggttagcaaa ttagtcatat ctgaacttaa agagggagga
     4981 atggattttt atgtgcccag acaagagtca atgttcagat ggatgaggtt ctcagatcta
     5041 agcacatggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgaa
     5101 tgacgccgct ccatctaatg atggtgctgc tggtctcgta ccagagggca acaacgagac
     5161 ccttccccta gaaccagttg cgggcgcagc tatagccgca cccgtcactg gccaaaataa
     5221 cataattgac ccctggatta gaacaaattt tgtgcaagca ccaaatggag agttcacagt
     5281 gtcacccaga aactctcctg gagaaatttt attaaactta gagttgagcc ctgatttgaa
     5341 cccttatttg gctcatttgt caaggatgta caatgggtat gctggtggag tggaagttca
     5401 ggttctcctg gcagggaacg cgttcactgc cggaaagatc ctcttcgccg ccgtcccgcc
     5461 aaatttccca gtggaattct taagcccagc ccagatcaca atgctcccac atttaatagt
     5521 agatgttagg actcttgaac caattatgat cccactccct gatgttagga atacattctt
     5581 ccattatagc aaccagccta acagccgcat gagattagtg gctatgctct ataccccact
     5641 cagatctaat ggctcaggtg atgatgtctt tactgtctct tgcagggttt tgactaggcc
     5701 tactcctgat tttgagttca cttatttagt gccaccttct gttgaatcta agactaagcc
     5761 tttttcctta cctattttaa ccctttctga gctcacaaat tcgaggttcc cagtccccat
     5821 cgattcgctt ttcaccgccc agaataatgt gttgcaggtg cagtgtcaaa atggcaggtg
     5881 tacacttgat ggtgagttac aaggcacaac ccagttgctc ccatctggca tctgtgcatt
     5941 cagaggacgg gtgacagcac aaattaacca acgtgacagg tggcacatgc aactgcaaaa
     6001 cctcaatggt acaacatatg acccaactga tgatgtgcca gccccgctgg gcacacctga
     6061 cttcaagggc gtcgtgtttg ggatggtaag ccaaagaaat gtgggtaatg atgcgcctgg
     6121 ctcaaccaga gcccaacagg cgtgggtttc aacctatagc ccccaatttg tccccaaatt
     6181 aggttctgtc aatcttagaa ttagtgataa tgatgatttt caattccagc cgacgaaatt
     6241 cacaccagtg ggcgtcaatg atgacgatga tggccacccg ttcagacaat gggaactacc
     6301 aaactactca ggggagctta ccttgaatat gaatcttgcc cccccagttg ctccaaattt
     6361 tcctggtgaa caattgttat tcttcagatc tttcgtgcca tgctcaggag gttacaacca
     6421 aggtattata gattgtctta ttccccaaga atggattcaa cacttctatc aggaatcagc
     6481 accctcccag tcagacgtgg ccctaatcag gtatgtcaac cccgatacgg gacgtacact
     6541 gtttgaagca aaattgcaca gatctggtta cattactgtg gctcattctg gagactatcc
     6601 tcttgttgtt ccggctaatg gacactttag atttgattct tgggtaaatc agttttactc
     6661 actcgcccca atgggaactg ggaatgggcg aaggagggct cagtaatggc tggggctttc
     6721 attgcaggat tggcaggcga catgctcacg tcatctgtgg gctcccttgt gaacgcagga
     6781 gcaaacgcca tcaaccaaaa gatagacttt gaaaacaacg aacaactcca gtctgcttcc
     6841 tttcagcatg ataaagagat gctccaagcg caggtgaagg caaccaagca gctgcaatct
     6901 gaaatgatag ctctaaaaca gggggttttg gccgcaggcg gcttttcccc cactgatgca
     6961 gcaaggggcg ccattggtgc acccatgaca aaggtgcttg actggtctgg cactcgatac
     7021 tgggcgccca attccacaaa gacaactggt tattcgggac aattcacctc ttcacctgtg
     7081 cacatgtcta gcccaaatgc tccacaatca aaacctgcaa aacctaggtc tctagctcct
     7141 tcctcttctt ctagcagtgt ctatagtacg tatactcaat ctgctcattt aacatctggc
     7201 tcttctagta atgcttcttc tgcctctaca aaattgacaa atttaagttt tggctcctct
     7261 ttaaacagaa cagcagaggg ggtaaatcaa cagagaagtt ttagcccttt catgaggggg
     7321 gcacttagca tttcccatgt cccccccccc ccaagtaggg cttccagttt tgggacggtt
     7381 tcgcccgtgc ccaaggaagt tttggactcc tggacgtttg cgtttaacac acacagacag
     7441 ccgcttttcc cccccctcag agtgaggggg gggtcccgtg tttagtgaaa aaaaaaaatt
     7501 ggctataatg tgatttcttt ttaaaatttg gttaatttgt gttttttaaa aa
//