Typing tool

Complete norovirus genomes

KP407451  GI.6
 GI.P11

Length: 7,691 | 3 CDS

ORF1: 5..5371
ORF2: 5355..6977
ORF3: 6977..7606
LOCUS       KP407451                7691 bp    RNA     linear   VRL 20-JUN-2015
DEFINITION  Norovirus GI strain GI/Hu/CHN/2008/Huzhou/N11, complete genome.
ACCESSION   KP407451
VERSION     KP407451.1
KEYWORDS    .
SOURCE      Norovirus GI
  ORGANISM  Norovirus GI
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7691)
  AUTHORS   Ji,L., Wu,X., Chen,L., Xu,D., Shen,Y., Zha,Y., Zhu,X. and Han,J.
  TITLE     Molecular Characteristics of Noroviruses Causing Outbreaks of Acute
            Gastroenteritis in Huzhou
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7691)
  AUTHORS   Ji,L., Wu,X., Chen,L., Xu,D., Shen,Y., Zha,Y., Zhu,X. and Han,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JAN-2015) Microbiological Laboratory, Huzhou Center
            for Disease Control and Prevention, 999 Changxing Road, Wuxing,
            Huzhou, Zhejiang 313000, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7691
                     /organism="Norovirus GI"
                     /mol_type="genomic RNA"
                     /strain="GI/Hu/CHN/2008/Huzhou/N11"
                     /isolation_source="stool samples"
                     /host="Homo sapiens"
                     /db_xref="taxon:122928"
                     /country="China"
                     /collection_date="2008"
                     /note="genotype: GI"
     CDS             5..5371
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AKM20817.1"
                     /translation="MMMASKDVVATNVASNNNANNTSATSRFLSRFRGLGGGASPPNP
                     IKIKSTEMALGLIGKTTQEAAGAGDLPPKQQRDRPPRTQEEVQYDMGWTERPMDQNVK
                     SWEELDTSTKEEILDSHKEWFDAGGLGPCTMPSTCEQAKDDSPPGEQVRWSARDGVNL
                     GVNRLTTVSGPEWNLCPLPPTDLRNMEPASEPTIGDMIEFYEGHIYHYSIYIGQGKTV
                     GVHSPQAAFSVARVTIQPIAAWWRVCYIPQPKHRLSYDQLKELENEPWPYAAITNNCF
                     EFCCQVMNLEDTWLQRRLITSGRFHHPSQPWSQQTPEFQQDSKLELVRDAILAAVNGL
                     VSQPFKNFLGKLKPLNVLNILSNCDWTFMGVVEMVILLLELFGVFWNPPDVSNFIASL
                     LPDFHLQGPEDLARDLVPVILGGIGLAIGFTRDKVTKVMKSAVDGLRAATQLGQYGLE
                     IFSLLKKYFFGGDQTERTLKGIEAAVIDMEVLSSTSVTQLVRDKQAAKAYMNILDNEE
                     EKARKLSAKNADPHVISSTNALISRIAMARSALAKAQAEMTSRMRPVVIMMCGPPGIG
                     KTKAAEHLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMTKIQDDCNK
                     LQAIADSAPLTLNCDRIENKGMQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVY
                     CSAPEVEQIRRVSPGDTSALKDCFKPDFSHLRMELAPQGGFDNQGNTPFGKGVMKPTT
                     INRLLIQAVALTMERQDEFRLQGKMYDFDDDRVSAFTTMARDNGLGILSMASLGKKLR
                     GVTSMEGLKNALKGYKVGACTIKWQAKVYSLESDGNSVNIREEKNVLTQQQQSVCAAS
                     IALARLRAARAVAYASCIQSAITSILQIAASALVVNRAVKRMFGTRTAALSLEGPPKE
                     HKCKVHQAKAAGKGPIGHDDMIDRYGLCETEEDEEVVHTEMPSATIEGKNKGKNKKGR
                     GRKNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDG
                     GIGETEMEIRHRVFYKSKNKKHHQEERRQLGLVTGSDIRKRKPIDWTPPKSAWADDER
                     EVDYNERINFEAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPSSAKEFFGEPLASI
                     AIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIA
                     SMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKS
                     GNTVVCAVQASEGETTLEGGDKGHYAGHEIIKHGSGPALSTKTKFWKSSPEPLPPGVY
                     EPAYLGGRDPRVSGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSSLEQVMD
                     TPVPWSYSDACQSLDKTTSSGFPHHKKKNDDWNGTAFIRELGEQAAHANNMYEQAKSM
                     KPMYTAALKDELVKPEKVYQKVKKRLLWGADLGTVIRAARAFGPFCDAIKSHTIKLPI
                     KVGMNSIEDGPLIYAEHSKYKYHFDADYTAWDSTQNRQIMTESFSIMCRLTASPELAS
                     VVAQDLLAPSEMDVGDYVIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDV
                     IQSMSYFSFYGDDEIVSTDIEFDPAKLTQVLKEYGLKPTRPDKSEGPIIVRKNVDGLV
                     FLRRTISRDAAGFQGRLDRASIERQIYWTRGPNHSDPFETLVPHQQRKVQLISLLGEA
                     SLHGEKFYRKISSKVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVN
                     DDGV"
     gene            5355..6977
                     /gene="vp1"
     CDS             5355..6977
                     /gene="vp1"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="vp1"
                     /protein_id="AKM20818.1"
                     /translation="MMMASKDAPTSPDGASGAGQLVPEANTAEQISMDPVAGASTAVA
                     TAGQVNMIDPWIFNNFVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYNG
                     WVGNMRVRILLAGNAFTAGKIIICCVPPGFDARILTIAQATLFPHLIADVRTLEPVEL
                     PLEDVRNVLYHNSSQPQPTMRLVAMLYTPLRTGGGSGGTDAFVVAGRVLTCPAPDFSF
                     LFLVPPSVEQKTRVFSVPNIPLKDLSNSRVPVPIQGMFMSPDVNQSVQFQNGRCQIDG
                     QLQGTTPVSLSQLCKIRGKTSSNARVLNLSEVDGTPFIPLESPAPVGFPDLGGCDWHV
                     NFSFQTQDRDPSQSVTFATNDASFVPYLGSVSPHNGEGFQAGDIIGSLGWISAPSDNS
                     QFNVWAIPKYGSSLPDVTHLAPAVFPPGFGEVILYFYSTFPGSGQPSQLQVPCLLPQE
                     FITHFCNEQAPIAGEAALLHYVDPDTGRNLGEFKLYPDGFMTCVPNSVSSGPQTLPIN
                     GVFVFVSWVSRFYQLKPVGTASAARRLGLRRI"
     gene            6977..7606
                     /gene="vp2"
     CDS             6977..7606
                     /gene="vp2"
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="vp2"
                     /protein_id="AKM20819.1"
                     /translation="MAQAVIGAIAASAAGSILGAGIQAGAEAGLQAQRYQQDLQLQQN
                     SFKHDKEMLGYQVQASNALLAKNLNTRYALLRAGGLSSADAARAVAGAPVTRIVDWNG
                     TRIAAPTSSTTTLRSGGFMAVPIPLSSKTKQPVMSGQDNPNYATSSISRTASWVQSQN
                     SMRSVSPFHSDALRTVWVTPPGSSSTSSVQSSFNGVFNTDRLPLFANRR"
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcgactaat gttgcaagca acaacaatgc
       61 taacaacact agtgctacat ctcgattttt gtcgagattt aggggtttag gtggtggcgc
      121 gagcccccct aaccccataa agatcaaaag cacagaaatg gccttgggtt tgattggcaa
      181 gacaacccaa gaggcagcag gggccggtga cctgccacct aaacagcaaa gagaccgacc
      241 ccccaggacc caagaggaag tccagtacga catgggatgg accgaaaggc ccatggacca
      301 gaatgttaag tcatgggagg aacttgacac ctctaccaag gaagagattt tggacagcca
      361 caaagaatgg tttgatgctg gcggtttggg cccgtgcaca atgccctcaa cttgtgaaca
      421 ggctaaagat gatagcccac ctggtgagca agtcagatgg tcggcgcgtg atggagtcaa
      481 ccttggagtg aatcgtctca caacggtgag tggccccgag tggaatctct gtcctctacc
      541 ccccactgac ctaaggaata tggaaccagc tagtgaaccc accattggag acatgataga
      601 gttctatgag ggtcatatct accactactc catatatatt gggcaaggaa agacagttgg
      661 tgtgcattcc ccacaagcgg cattctcagt ggctagagta accatccaac ctatagctgc
      721 ttggtggagg gtttgttata taccccagcc caaacataga ttgagttacg accagctcaa
      781 ggaattggaa aatgaacctt ggccatatgc agctatcacc aacaattgtt ttgagttttg
      841 ctgtcaagtc atgaatcttg aggacacatg gttgcagagg cggctaataa catcaggtag
      901 gttccaccac ccttcccagc cttggtcaca acagacccct gaatttcagc aggatagcaa
      961 gctagaacta gttagggatg ccatattggc cgcggtgaat ggccttgttt cacaaccctt
     1021 caagaatttc ttgggcaagc tcaagcctct taacgtattg aacatcctat ctaactgtga
     1081 ttggaccttt atgggggtgg tagagatggt tatattgctt cttgagctct ttggcgtatt
     1141 ctggaatccg cctgatgtgt ctaactttat agcatctctc ctccctgatt tccatctcca
     1201 gggaccagaa gacctggccc gggatttggt gccagtcatt cttggtggta tagggctagc
     1261 cattggattt accagagaca aagtcactaa ggttatgaag agtgctgtag atgggctccg
     1321 ggctgctacg caactggggc aatacgggtt agaaatattc tcactcctga agaagtattt
     1381 ctttggtggg gatcagactg aacggaccct caaaggcatt gaagcagcag ttatagatat
     1441 ggaggtcttg tcctctacat cagtaacaca actggtgaga gacaagcagg cagctaaagc
     1501 ttacatgaac atcctggata atgaagagga aaaagctaga aaactctctg ctaagaatgc
     1561 tgacccccat gtaatatcct caacaaatgc cctaatatca cgtatagcca tggcacggtc
     1621 cgctctggct aaggctcaag ctgagatgac cagccgaatg aggccagtcg tcatcatgat
     1681 gtgcggacct cctggaattg ggaagactaa agcagcggaa cacttggcaa aacgcctggc
     1741 caatgagatc aggcctggcg gcaaagtggg actagtgcca cgtgaggctg ttgaccactg
     1801 ggatggctac catggtgagg aagtgatgct atgggatgac tatggtatga caaagataca
     1861 agatgactgc aacaagctcc aggctattgc tgactctgcc ccactcactc tcaactgtga
     1921 caggattgaa aataaaggga tgcagtttgt gtcagatgca atagtcatca ccaccaacgc
     1981 cccagggccc gcccctgtgg atttcgtcaa tctcggccct gtgtgcagac gggttgactt
     2041 tctagtttac tgttccgccc cagaggtaga gcagataagg agagtcagcc ctggcgacac
     2101 gtcggcactg aaagattgtt tcaagccaga tttctcccac ttgaggatgg agttagctcc
     2161 tcaagggggg tttgacaacc aggggaacac accattcggc aagggtgtta tgaaaccaac
     2221 aaccatcaat agactcctca tacaagctgt ggctctcacc atggagagac aggatgagtt
     2281 ccggctccaa ggaaaaatgt atgattttga tgatgacagg gtgtcagcct tcaccaccat
     2341 ggcacgcgat aatggattgg gcatcctgag tatggcgagc ctaggtaaga aactgcgcgg
     2401 tgtcacatcg atggaaggtc tgaagaatgc tctgaaagga tacaaagttg gcgcgtgtac
     2461 aattaagtgg caggccaagg tttattcact ggaatcagat ggcaacagtg ttaacattag
     2521 ggaggagaag aacgtcttaa ctcaacaaca gcagtcagtg tgcgctgcct ccattgcact
     2581 tgcccgcctg cgggccgcgc gcgcggttgc gtatgcgtca tgcatccaat cagctataac
     2641 ctccatacta caaattgctg cctcggccct agtggtcaat agggccgtga aaagaatgtt
     2701 tggcacacgc actgctgctt tgtcactaga gggccccccc aaagaacaca agtgcaaagt
     2761 ccaccaggct aaagccgcag ggaaagggcc cattggtcat gatgatatga ttgacagata
     2821 tggactatgt gagactgagg aggatgaaga ggtagtccat actgagatgc cttccgccac
     2881 catagaaggc aagaacaaag gtaagaacaa gaaagggcgc ggccgaaaga acaactacaa
     2941 tgccttttcc cgtagaggac ttaatgatga agagtatgaa gagtacaaga aaatacggga
     3001 agagaagggt ggaaattaca gcattcagga gtacctagag gatagacaaa ggtatgaaga
     3061 ggagctcgct gaggttcaag caggtggaga cggaggaatc ggcgaaaccg aaatggaaat
     3121 ccgccataga gtgttctata agtctaaaaa caagaagcac caccaggaag agcggcgcca
     3181 attgggatta gtcacgggtt ccgacatccg gaaaaggaaa ccaattgatt ggactccccc
     3241 taagtcagca tgggcagatg atgagcgtga agtggattac aatgagagaa tcaactttga
     3301 ggcgcccccc actttgtgga gccgagttac aaagtttggg tctgggtggg gtttttgggt
     3361 cagccccaca gtcttcataa ccacaacgca cgttatacca agcagtgcaa aagaattctt
     3421 tggtgaaccc cttgccagca tagccatcca tagggccgga gaattcaccc tcttcaggtt
     3481 ctctaagaaa atcaggcccg atctcacggg catgattctt gaggaaggtt gtccagaagg
     3541 tacggtgtgc tcagtgttaa taaaaaggga ctccggtgag ctactaccac tagctgtaag
     3601 aatgggcgca atagcatcaa tgcgcataca gggtcgtctt gtccatggtc agtctggtat
     3661 gttgctcact ggggcgaatg ctaagggcat ggaccttgga actattccag gggactgtgg
     3721 agctccctat gtttacaaga gagcaaatga ctgggtggtc tgcggtgtac acgctgctgc
     3781 cactaaatca ggcaacacgg tggtgtgcgc cgtccaagct agtgaagggg agaccacact
     3841 tgaaggaggt gacaaaggcc actatgccgg gcatgagata atcaagcatg gaagtgggcc
     3901 agccctgtca accaaaacaa agttctggaa atcatcccct gaaccattac cccccggggt
     3961 ctatgaaccc gcatacctcg gtggccggga tccaagagtg agtggtggcc cctcgctcca
     4021 acaggtatta cgggatcagt tgaagccatt tgctgagcca cgggggcgta tgccagaacc
     4081 aggtctcctg gaggccgcag ttgagactgt gacctcatca ctggagcagg ttatggacac
     4141 cccagtaccg tggagttaca gtgatgcatg tcaatccctg gacaaaacta ctagctcagg
     4201 tttcccccac cataagaaaa agaatgatga ttggaacggc accgccttca ttagagagtt
     4261 gggagagcag gcggcacacg ccaataacat gtatgagcaa gccaagagca tgaagcccat
     4321 gtacacggcg gcgcttaagg atgaattagt gaagccagaa aaagtgtacc aaaaagtgaa
     4381 gaagcgtctg ctttgggggg cagacctagg aactgtgatc cgggccgcac gggcttttgg
     4441 cccgttctgt gatgccataa agtcccacac aattaaacta cctatcaaag ttgggatgaa
     4501 ttcaatcgag gatggaccat taatttatgc agagcattca aaatataaat atcactttga
     4561 tgcagactat acggcttggg actcaacaca aaacaggcaa attatgactg aatcattctc
     4621 aatcatgtgt cggctaactg cttctccaga attggcctca gtggtggcac aagatctgct
     4681 tgcaccctcg gaaatggacg ttggtgacta tgtcataaga gtgaaggaag gcctcccatc
     4741 cggctttcca tgcacatcac aagtcaatag tataaaccat tggttgataa ctttgtgtgc
     4801 cctctctgag gtgactggcc tgtcaccaga tgttattcag tctatgtcat acttttcttt
     4861 ctatggtgat gatgaaatag tgtctactga tatagaattt gacccagcaa aattgacaca
     4921 ggtccttaaa gagtatggcc tcaaacccac ccgccctgac aagagtgagg gtccaataat
     4981 tgtgaggaag aatgtggatg gcctagtctt cttacgtcgc actatttccc gcgacgccgc
     5041 ggggttccaa gggcggctag accgagcatc cattgaaaga cagatctatt ggaccagagg
     5101 gcccaatcac tcagacccct ttgaaacttt ggtgccccac caacaaagga aagtccaatt
     5161 gatatcactg ttaggtgagg cttcattgca tggtgaaaag ttctacagga agatctcaag
     5221 caaagtcatc caagagatta agacaggggg ccttgaaatg tacgtaccag ggtggcaagc
     5281 catgttccgc tggatgcggt tccacgatct tggcctgtgg acaggagatc gcaatctcct
     5341 gcccgaattc gtaaatgatg atggcgtcta aggacgctcc aacatcccct gatggcgcta
     5401 gtggcgccgg ccagctggta ccggaggcta atacagctga gcaaatctca atggaccctg
     5461 ttgcgggtgc ttcaacagca gtcgcaacgg ctgggcaagt taacatgatt gacccatgga
     5521 tcttcaataa ctttgtccaa gcgccccaag gagaattcac tatttcccct aataataccc
     5581 ccggtgatat tttgtttgat ctacaactag gaccccatct taacccattt ctagcccatc
     5641 tctcacagat gtataatggt tgggtcggca atatgcgtgt gcgcatattg ttggccggca
     5701 acgccttcac agctggaaag ataatcattt gctgtgtccc ccctggcttt gatgctagaa
     5761 tactcacaat agctcaagca actctcttcc cacatttgat tgctgacgtt aggacccttg
     5821 agcctgtgga gcttcctttg gaggacgtac gcaacgttct ctaccacaac agtagccagc
     5881 cgcagccaac aatgcggctg gttgctatgt tgtatacccc cctccgcact ggtggtggtt
     5941 ctggaggcac tgatgccttt gtggtggcgg gcagggtgct tacgtgcccc gcccctgact
     6001 ttagcttttt gtttcttgtt cccccttccg ttgaacaaaa gaccagagtt tttagtgtcc
     6061 ccaatatacc tctgaaagat ctctcaaatt ctcgtgtccc tgtgcctata cagggcatgt
     6121 ttatgtcccc agatgttaat cagtcagtcc agtttcaaaa cgggcgctgc caaattgatg
     6181 gtcaactcca gggcaccacc ccagtctcgc tcagccaact ctgcaagatt aggggtaaaa
     6241 cttcaagcaa tgccagggtg ctcaacttga gtgaggtaga tggtacaccc ttcatccccc
     6301 ttgaatcacc agcgccagta ggttttcccg acttaggagg ctgtgactgg cacgtaaatt
     6361 tctctttcca gactcaagat cgggacccat ctcaaagtgt gacctttgca accaatgatg
     6421 ccagctttgt tccctaccta ggtagtgtct cccctcacaa tggggaaggt tttcaagcag
     6481 gcgacatcat aggtagcctt gggtggattt cagccccgtc tgataattca caatttaatg
     6541 tttgggcaat accaaagtat ggatctagtc tcccagatgt cacccatctt gctcctgctg
     6601 tgttcccccc aggctttggg gaggtgatcc tatatttcta ctccaccttc ccaggttctg
     6661 gacaacccag tcaacttcaa gtcccatgtt tgttacctca ggagttcatc acccacttct
     6721 gcaacgaaca ggctcccatc gctggggagg ctgccctcct ccactacgtg gaccctgaca
     6781 cggggcgaaa cttgggggaa ttcaaacttt atcctgatgg atttatgacc tgtgtcccta
     6841 atagtgttag cagtggccct caaacccttc ccattaatgg agtctttgtc tttgtttcat
     6901 gggtatccag attctatcaa ctcaagcctg tgggaacggc ctcagcggct agaaggcttg
     6961 gattgcggcg tatataatgg cccaagctgt catcggtgcc atagccgcgt ctgccgctgg
     7021 tagtatacta ggggcgggca tacaggctgg tgctgaggct ggtctccagg ctcaacggta
     7081 ccagcaggat ttacaattgc aacaaaattc tttcaagcat gataaggaaa tgttaggcta
     7141 tcaggttcag gctagtaatg ctcttttagc taagaatctt aacactaggt atgctcttct
     7201 gcgggcaggg ggcctatcta gtgctgatgc tgctcgggca gtggctggtg cccctgtcac
     7261 ccgtatagtg gactggaatg gcacgcggat tgcagcgcct acctcaagca ccactacact
     7321 cagatctggt ggttttatgg ctgtccctat accattgtct tcaaagacca agcaaccagt
     7381 gatgtctggg caggataatc caaattatgc tacttcttct atctctagaa ctgcttcatg
     7441 ggtgcaatct caaaattcta tgagatctgt ttctcctttc cacagtgatg ctctgagaac
     7501 cgtgtgggtc acaccaccag gttcatcatc aacttcatct gtgcaatcta gttttaatgg
     7561 tgtttttaat acagatagat tgcctctgtt cgcaaacaga aggtaatatt ttgtaatagg
     7621 atgccggtgg gcaccatatt cagatttggt tttaattgat attttaatta caatttggct
     7681 taattggtgt t
//