Typing tool

Complete norovirus genomes

KM258130  GII.4 New Orleans
 GII.P4 Yerseke

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       KM258130                7559 bp    RNA     linear   VRL 01-AUG-2015
DEFINITION  Norovirus 12-AY-1/2012/GII.4/NewOrleans/2009, complete genome.
ACCESSION   KM258130
VERSION     KM258130.1
KEYWORDS    .
SOURCE      Norovirus 12-AY-1/2012/GII.4/NewOrleans/2009
  ORGANISM  Norovirus 12-AY-1/2012/GII.4/NewOrleans/2009
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Wu,F.-T., Katayama,K., Park,Y., Chen,H.-C., Wu,C.-Y. and Lu,C.-T.
  TITLE     Norovirus GII.4 gastroenteritis outbreaks
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Wu,F.-T., Katayama,K., Park,Y., Chen,H.-C., Wu,C.-Y. and Lu,C.-T.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUL-2014) Centers for Disease Control department of
            health Taiwain, R.O.C., Center for Research and Diagnostics, No.
            161, Kun-Yang Street, Taipei, Taiwan 115, R.O.C.
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Genomics Work Bench v. version 7
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus 12-AY-1/2012/GII.4/NewOrleans/2009"
                     /mol_type="genomic RNA"
                     /isolate="12-AY-1/2012/GII.4 NewOrleans 2009"
                     /isolation_source="stool specimen from a 90-year old male
                     with diarrhea"
                     /host="Homo sapiens"
                     /db_xref="taxon:1631322"
                     /country="Taiwan"
                     /collection_date="Mar-2012"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural protein"
                     /protein_id="AJZ77032.1"
                     /translation="MKMASTDASAAAVAISNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREKPQRPPRPPTPELVKNIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELAPLSLYWRPVYTPQYLISPDTLRKLSGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKIKKVANIFLCALSSLFTRPIKDIIGK
                     IRPLNILNILASCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGSED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVRTM
                     PELKQALKNVSIKKCQIVYSGCTYILESDGKGNVKVDRIQSAAVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQDLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKAEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPTLSTKTKFWRSSTASLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLRPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHGDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="AJZ77033.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIPGSRNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTNGSTRGHKATVYTGSADFSPKLGRVQFATDTDNDFETNQNTKFTPVGVIQDG
                     STTPRNEPQQWVLPSYSGRNIHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="AJZ77034.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGAPPGRTNLRATVPARGSSSTSS
                     NSSIATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta ctgacgcttc cgctgccgct gttgctatca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt tcaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaaaa ccacaaagac ccccacgacc
      181 acctacgcca gaactagtta aaaatattcc ccctccccca cccaacggag aggatgaaat
      241 agtggtttct tatagtgtca aggatggtgt ttccggcttg cctgaccttt ccaccgtcag
      301 gcaaccggaa gaatccaaca cggccttcag tgtcccccca ctcaatcaga gggagaatag
      361 agatgctaag gaaccactta ctggaacaat tctggaaatg tgggacgggg aaatctacca
      421 ttatggcctg tatgtggagc gaggtcttgt actgggtgtg cacaaaccac cagctgccat
      481 cagcctcgct agggttgagc tagcaccact ctccttgtac tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acactctcag gaaattatcc ggagaaacgt tcccctacac
      601 agcctttgac aacaactgtt atgccttttg ttgctgggtc ctggacctaa atgattcgtg
      661 gctgagcagg agaatgatcc agagaacaac tggtttcttc aggccctacc aagactggaa
      721 taggaaaccc cttcccacta tggatgactc caaaataaag aaggtagcta atatattcct
      781 gtgtgccctg tcctcgctgt tcaccagacc cataaaagat ataataggga agataaggcc
      841 ccttaacatc ctcaacatct tagcctcgtg tgattggact tttgcaggtg tagtggagtc
      901 cctgatactc ttggcagaac tctttggagt tttctggacg cccccagatg tgtctgcgat
      961 gattgccccc ttacttggcg actacgagct acaagggtct gaggaccttg cagttgagct
     1021 cgtccccgtg gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 gaaaatgttg tcatctgctg cgtccacctt gagagcttgt aaagaccttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaggaag aggcaaatga
     1201 gctggctata gtgaggtcca tcgaggatgc agtcctggat ctcgaggcaa tcgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagtctggca acctatatga gaacacttga
     1321 ccttgaggag gagaaagcca ggaaactctc aaccaagtct gcctcacccg acatcgtggg
     1381 cacaatcaac gccctcctgg cgaggatcgc tgccgcacgt tctctggtgc accgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt ggtgttgatg atatcaggca ggccaggaat
     1501 agggaagacc cacctcgcta gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgtg ggcctcatcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg attatggaat gagcaaccct attcacgatg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaactgt gacaggatcg aaaataaagg
     1741 aaaggtcttt gacagcgatg tcatcatcat caccactaat ctggccaacc cagcgccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaagtc gaaaaggcga agcgtgactt cccaggccaa cctgacatgt ggaagaacgc
     1921 tttcagttct gatttctcac acataaaact agcactggcc ccacagggtg gtttcgacaa
     1981 gaacgggaac accccacacg gaaagggcgt tatgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gttagatgaa tttgaactgc agggcccagc
     2101 tctcaccacc ttcaatttcg atcgcaataa ggtgcttgcc tttagacagc ttgctgctga
     2161 aaataaatat ggattgatgg acacaatgag agttgggaaa cagctcaagg atgtcagaac
     2221 catgccagaa ctcaaacaag cactcaagaa tgtctcaatc aagaagtgtc aaatagtgta
     2281 tagtggttgc acctacatac ttgagtctga tggcaagggc aatgtgaaag ttgacagaat
     2341 ccaaagcgcc gccgtgcaga ccaacaatga gctggctggt gccctgcacc atttgaggtg
     2401 cgccagaatc agatactatg tcaagtgtgt ccaggaggcc ctgtattcca tcattcaaat
     2461 cgctggggct gcatttgtca ccacgcgcat tgccaagcgc atgaacatac aagacctatg
     2521 gtccaagcca caagtggaaa acacagagga gactaccagc aaggacgggt gcccaaaacc
     2581 taaggacgat gaggagttcg tcatttcatc cgacgacatc aaagctgagg gtaagaaagg
     2641 gaagaacaag actggccgcg gcaagaagca cacagcattt tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca agaggatcag agaagaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcaactga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcctctct cggtctggtc acaggctctg aaattaggaa
     2941 aagaaaccca gatgacttca aacccaaagg gaagttgtgg gctgacgatg acaggagtgt
     3001 agactacaat gagaaactca gttttgaggc cccaccaagc atctggtcga gaatagtcaa
     3061 ctttggttca ggctggggat tttgggtctc ccccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaatac aggtacacaa
     3181 gtcgggcgag ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggcgcac ctgagggcac cgtggtcaca ctactcatca aaaggtccac
     3301 tggggaactc atgcccctag cagctaggat ggggacccat gcgaccatga agatccaagg
     3361 gcgcactgtt ggaggccaga tgggcatgct tctgacagga tccaacgcca agagcatgga
     3421 cctgggtact acaccaggtg attgtggctg cccctacatc tacaagagag gtaatgacta
     3481 tgtggtcatt ggggtccaca cggctgccgc acgtgggggg aacactgtca tatgtgccac
     3541 ccaggggagt gaaggagagg ctacacttga aggtggtgac aacaagggga catactgtgg
     3601 cgcaccaatc ctaggcccag ggagtgcccc aacacttagc accaagacca aattctggag
     3661 atcttccaca gcatcactcc cacctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 ccctagggtc aagggtggtc cttcactgca gcaagtcatg agggaacagt tgaagccatt
     3781 cacagagccc aggggcaagc caccaaaacc aagtgtgtta gaagctgcca agaagaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtcccta gacaagacca cttccagtgg tcatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacagct gcgctcaagg atgagttagt
     4081 taaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggacctggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgtcacactt cctattagag ttggcatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcattcc aggtacacat atcactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgctggcag cagctctaga aatcatggtt aaattctccc cagaaccaca
     4381 cttggctcag gtagtcgcgg aggaccttct ctctcctagc gtggtggacg tgggcgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgcgc gctctctgaa gtcacaaacc tgtcccctga
     4561 taccatacag gctaactccc tcttctcttt ttatggtgat gatgaaattg ttagtacaga
     4621 cataaaattg gacccagaaa aattgacagc aaagctcaga gaatatgggt taagaccaac
     4681 ccgccctgac aaaactgaag gaccccttgt catctctgaa gacctgaatg gcctaacttt
     4741 cctgcggaga actgtgactc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg tcccaaccat ggagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaatt gatgtcccta ctgggggagg ccgccctcca
     4921 cggcccagca ttctacagca aaatcagcaa attggtcatt gcagagctaa aagagggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaaccttgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgta gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccctaggc cctgacttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc gactgaaggt ttgagcccca gccaggtcac tatgttcccc cacataatag
     5521 tagatgttag gcaattggaa cctgtgttga ttcccttacc cgatgttagg aataatttct
     5581 accattataa tcaatcaaat gactccacca tcaaattgat agcaatgttg tatacaccac
     5641 ttagggctaa taatgccggg gacgatgtct tcacagtttc ttgtcgagtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttgg tgccacccac agttgaatca agaactaaac
     5761 cattctctgt cccagtttta actgttgagg agatgaccaa ttcaaggttc cccattcctt
     5821 tggaaaagtt gttcacgggc cccagtagtg cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggtacta cccaactgtc tcccgtcaac atctgcacct
     5941 tcagagggga tgtcacccat attccaggca gtcgtaacta cacaatgaat ttggcctccc
     6001 aaaattggaa cagttacgat ccaacagaag aaatcccagc ccctttagga actccagatt
     6061 tcgtggggaa gattcaaggt gtgctcaccc aaaccacaag gacaaatggc tcgacccgcg
     6121 gccacaaagc tacagtgtat actgggagcg ccgacttttc tccaaaactg ggtagagttc
     6181 aatttgccac tgacacagac aatgattttg aaactaacca aaacacaaag ttcaccccag
     6241 tcggtgttat ccaggatggt agtaccaccc cccgaaatga accccaacaa tgggtgctcc
     6301 caagttactc aggcagaaac attcacaatg tgcacctggc ccccgctgta gcccccactt
     6361 tcccgggcga gcagctcctc ttcttcagat ctactatgcc cggatgcagc gggtatccca
     6421 acatggactt ggactgtctg ctcccccagg aatgggtgca gtatttctac caggaggcag
     6481 ccccagcaca atctgatgtg gccctgctaa gatttgtgaa tccggacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcatact ggccaacatg
     6601 atttggttat cccccccaat ggttacttta gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat gggacggggc gtagacgcgc attgtaatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgttcttgg ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggcc atcaaccaga aagttgaatt tgaaaacaac agaaaattgc aacaagcttc
     6841 tttccaattt agtagcaatc tacaacaggc ttccttccaa catgacaaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaagcaat
     6961 gctcctagag ggtggattct ctgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaagct ttggactgga gcgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atataatgca ggccgctttt ccacccccca accctcgggg gcaccaccag gaagaactaa
     7141 tcttagggct actgtccccg cccggggttc ctccagcacg tcctctaact cttctattgc
     7201 tacttctgtg tattcaaatc aaaccacctc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccataacatc tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgca ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt cttttcttta gtgtctttt
//